DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mos and Ripk3

DIOPT Version :9

Sequence 1:NP_610817.1 Gene:Mos / 36404 FlyBaseID:FBgn0033773 Length:364 Species:Drosophila melanogaster
Sequence 2:NP_647558.2 Gene:Ripk3 / 246240 RGDID:628899 Length:478 Species:Rattus norvegicus


Alignment Length:347 Identity:85/347 - (24%)
Similarity:129/347 - (37%) Gaps:123/347 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 LGRGAYGTVFKAIYR--DRSVAVKIIRAQAASTLHNESHLLNLEHRNIVRLLK------------ 78
            :|:|.:|.||:|.:.  :..|||||:.::..|  .....::||.|.|::.||.            
  Rat    28 VGKGGFGAVFRARHTAWNLDVAVKIVNSKKIS--REVKAMVNLRHENVLLLLGVTENLEWDYVYG 90

  Fly    79 -------LESAADFGLVIMECPRGQSLQRIVDTLALPLMHRVLITLDVVAALRYCHSQN--VLHL 134
                   :|:.:..||:...|||           ..||:.|:|  .:||..:.|.||.|  :||.
  Rat    91 PALVTGFMENGSLSGLLQPSCPR-----------PWPLLCRLL--EEVVLGMCYLHSLNPSLLHR 142

  Fly   135 DVKPTNILVALGTKSSITCNSSKIKVKRSYICKLCDFGSSIEMG--EFCAWQEPSVAKGTLRYMS 197
            |:||:|:|                 :......||.|||.|...|  :..:......:.|||.|::
  Rat   143 DLKPSNVL-----------------LDPELHAKLADFGLSTFQGGSQSGSGSGSRDSGGTLAYLA 190

  Fly   198 PEALRSD-TLTEASDIYSLGITMWQLQARRLPYHTLDCNETIAYQVVKHELRPDNYHQLKILALD 261
            ||.|.:| ..::|||:||.|:.:|.:.|.| ....:|....|...|...:.||    .|..|..|
  Rat   191 PELLDNDGKASKASDVYSFGVLVWTVLAGR-EAEVVDKTSLIRGAVCNRQRRP----PLTELPPD 250

  Fly   262 SPIDCDWDLAHESTANVICRRANTSARRNLSLDPSYTVGRDLKKKRHRNRLALHFDSPAPEGSAC 326
            ||                                                     ::|..||   
  Rat   251 SP-----------------------------------------------------ETPGLEG--- 259

  Fly   327 SESAYSQLYKSCWVSAPELRLS 348
                ..:|...||.|.|:.|.|
  Rat   260 ----LKELMTHCWSSEPKDRPS 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MosNP_610817.1 STKc_Mos 19..298 CDD:270881 75/295 (25%)
S_TKc 26..257 CDD:214567 71/254 (28%)
Ripk3NP_647558.2 PKc_like 28..285 CDD:419665 85/347 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 311..330
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 362..429
RHIM 408..458 CDD:403811
RIP homotypic interaction motif (RHIM). /evidence=ECO:0000250|UniProtKB:Q9Y572 437..461
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0192
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.