DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mos and Mos

DIOPT Version :9

Sequence 1:NP_610817.1 Gene:Mos / 36404 FlyBaseID:FBgn0033773 Length:364 Species:Drosophila melanogaster
Sequence 2:NP_064487.3 Gene:Mos / 24559 RGDID:3103 Length:342 Species:Rattus norvegicus


Alignment Length:246 Identity:77/246 - (31%)
Similarity:119/246 - (48%) Gaps:44/246 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 LGRGAYGTVFKAIYRDRSVAVKII-------RAQAASTLHNESHLLNLEHRNIVRLLKL-----E 80
            ||.|.:|:|:||.|....||:|.:       ||...| ...|.::..|.|.||||::..     |
  Rat    68 LGSGGFGSVYKATYHGVPVAIKQVNKCTRNLRASQRS-FWAELNIARLHHDNIVRVVAASTRTPE 131

  Fly    81 SAADFGLVIMECPRGQSLQRIV-------DTLA----LPLMHRVLITLDVVAALRYCHSQNVLHL 134
            .:...|.:|||.....:|.:::       :.|:    |.|...:..:||:|..|.:.|||::|||
  Rat   132 GSNSLGTIIMEFGGNVTLHQVIYGATRSPEPLSCREQLSLGKCLKYSLDIVNGLLFLHSQSILHL 196

  Fly   135 DVKPTNILVALGTKSSITCNSSKIKVKRSYICKLCDFGSSIEMGEF-CAWQEPSVAKGTLRYMSP 198
            |:||.|||::                 ...:||:.|||.|.::.:. |.........||..:.:|
  Rat   197 DLKPANILIS-----------------EKDVCKISDFGCSQKLQDLRCRQASLHHIGGTYTHQAP 244

  Fly   199 EALRSDTLTEASDIYSLGITMWQLQARRLPYHTLDCNETIAYQVVKHELRP 249
            |.|:.:..|..:||||.|||:||:..|.:||....  :.:.|.||.:.|||
  Rat   245 ELLKGEIATPKADIYSFGITLWQMTTREVPYSGEP--QYVQYAVVAYNLRP 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MosNP_610817.1 STKc_Mos 19..298 CDD:270881 77/246 (31%)
S_TKc 26..257 CDD:214567 77/246 (31%)
MosNP_064487.3 STKc_Mos 58..329 CDD:270881 77/246 (31%)
S_TKc 64..331 CDD:214567 77/246 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166337540
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0192
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 105 1.000 Inparanoid score I4847
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D420914at33208
OrthoFinder 1 1.000 - - FOG0009419
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_109630
Panther 1 1.100 - - LDO PTHR23257
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X7157
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
109.800

Return to query results.
Submit another query.