DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mos and Map3k21

DIOPT Version :9

Sequence 1:NP_610817.1 Gene:Mos / 36404 FlyBaseID:FBgn0033773 Length:364 Species:Drosophila melanogaster
Sequence 2:NP_663583.2 Gene:Map3k21 / 234878 MGIID:2385307 Length:1002 Species:Mus musculus


Alignment Length:380 Identity:86/380 - (22%)
Similarity:138/380 - (36%) Gaps:127/380 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 PPVPTRC-------------QVLGRGAYGTVFKAIYRDRSVAVKIIR-------AQAASTLHNES 63
            ||.|..|             :::|.|.:|.|::|.::.:.||||..|       |.||.::..|:
Mouse    94 PPPPRPCSPVHVDFERLELKELIGAGGFGQVYRATWQGQEVAVKAARRDPEQDAAAAAESVRREA 158

  Fly    64 HLL-NLEHRNIVRLLKLESAADFGLVIMECPRGQSLQRIVDTLA-------------LPLMHRVL 114
            .|. .|.|.||::|..:........:::|..||.:|.|.:...|             :|....|.
Mouse   159 RLFAMLRHPNIIQLRGVCLRQPHLCLVLEFARGGALNRALAAAASDPRAPGPRRARRIPPQVLVN 223

  Fly   115 ITLDVVAALRYCHSQNV---LHLDVKPTNILVALGTKSSITCNSSKIKVKRSYICKLCDFGSSIE 176
            ..:.:...:.|.|.:.|   ||.|:|.:|||:....:....||.:         .|:.|||.:.|
Mouse   224 WAVQIARGMLYLHEEAVVPILHRDLKSSNILLLEKIEHDDICNKT---------LKITDFGLARE 279

  Fly   177 MGEFCAWQEPS--VAKGTLRYMSPEALRSDTLTEASDIYSLGITMWQLQARRLPYHTLDCNETIA 239
                  |...:  .|.||..:|:||.:||...::.|||:|.|:.:|:|....:||..:| ...:|
Mouse   280 ------WHRTTRMSAAGTYAWMAPEVIRSSLFSKGSDIWSYGVLLWELLTGEVPYRGID-GLAVA 337

  Fly   240 YQVVKHELRPDNYHQLKILALDSPIDCDWDLAHESTANVICRRANTSARRNLSLDPSYTVGRDLK 304
            |.|..                                                            
Mouse   338 YGVAV------------------------------------------------------------ 342

  Fly   305 KKRHRNRLALHFDSPAPEGSACSESAYSQLYKSCWVSAPELRLSSIQLKHELEFI 359
                 |:|.|...|..||       .:::|.|.||...|.:|.|...:..:|..|
Mouse   343 -----NKLTLPIPSTCPE-------PFAKLMKECWEQDPHIRPSFALILQQLTAI 385

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MosNP_610817.1 STKc_Mos 19..298 CDD:270881 71/317 (22%)
S_TKc 26..257 CDD:214567 67/256 (26%)
Map3k21NP_663583.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..26
SH3 28..82 CDD:302595
TyrKc 110..382 CDD:197581 80/359 (22%)
PKc_like 115..385 CDD:304357 81/357 (23%)
Leucine-zipper 1 409..430
Leucine-zipper 2 444..466
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 508..531
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 574..604
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 640..689
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 721..778
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 797..823
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 878..899
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0192
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.