DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mos and MLKL

DIOPT Version :9

Sequence 1:NP_610817.1 Gene:Mos / 36404 FlyBaseID:FBgn0033773 Length:364 Species:Drosophila melanogaster
Sequence 2:NP_689862.1 Gene:MLKL / 197259 HGNCID:26617 Length:471 Species:Homo sapiens


Alignment Length:326 Identity:81/326 - (24%)
Similarity:127/326 - (38%) Gaps:88/326 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 RKQLLKDGPPVPTRCQVLGRGAYGTVFKAIYRDRSVAVKII-RAQAAS------TLHNE-SHLLN 67
            :|:.|...|.:     :|......|::|..|....||:|:. :.||.|      |.:.| ..:..
Human   197 KKEQLSGSPWI-----LLRENEVSTLYKGEYHRAPVAIKVFKKLQAGSIAIVRQTFNKEIKTMKK 256

  Fly    68 LEHRNIVRLL-----KLESAADFGLVIMECPRGQSLQRIVD-TLALPLMHRVLITLDVVAALRYC 126
            .|..||:|:.     :..:...|.:|:..|..| :|:.::| ...|.|..|:::.|.....|...
Human   257 FESPNILRIFGICIDETVTPPQFSIVMEYCELG-TLRELLDREKDLTLGKRMVLVLGAARGLYRL 320

  Fly   127 HSQNV--LHLDVKPTNILVALGTKSSITCNSSKIKVKRSYICKLCDFGSSIEMGEFCAWQEPSVA 189
            |....  ||..::.:|.||..|                 |..||..|    |:.:    .:.|::
Human   321 HHSEAPELHGKIRSSNFLVTQG-----------------YQVKLAGF----ELRK----TQTSMS 360

  Fly   190 KGTLR----------YMSPEALRSDTLTE---ASDIYSLGITMWQLQARRLPYHTLDCN-ETIAY 240
            .||.|          |:||:.| .|...:   .|:|||.||.:|::....:|:.  .|| |.|..
Human   361 LGTTREKTDRVKSTAYLSPQEL-EDVFYQYDVKSEIYSFGIVLWEIATGDIPFQ--GCNSEKIRK 422

  Fly   241 QV-VKHELRPDNYHQLKILALDSPIDCDWDLAHESTANVICRRANTSARRNLSLDPSYTVGRDLK 304
            .| ||.:..|        |..|.|.:.. ::..|      ||..:.|.|      ||  |...||
Human   423 LVAVKRQQEP--------LGEDCPSELR-EIIDE------CRAHDPSVR------PS--VDEILK 464

  Fly   305 K 305
            |
Human   465 K 465

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MosNP_610817.1 STKc_Mos 19..298 CDD:270881 75/309 (24%)
S_TKc 26..257 CDD:214567 64/261 (25%)
MLKLNP_689862.1 N-terminal bundle and brace (NBB), mediates INSP6 binding. /evidence=ECO:0000269|PubMed:29883610 1..149
PHA02988 177..469 CDD:165291 81/326 (25%)
PKc_like 215..466 CDD:304357 77/303 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0192
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.