DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mos and Y105C5A.24

DIOPT Version :9

Sequence 1:NP_610817.1 Gene:Mos / 36404 FlyBaseID:FBgn0033773 Length:364 Species:Drosophila melanogaster
Sequence 2:NP_502888.2 Gene:Y105C5A.24 / 190882 WormBaseID:WBGene00013643 Length:478 Species:Caenorhabditis elegans


Alignment Length:413 Identity:105/413 - (25%)
Similarity:166/413 - (40%) Gaps:101/413 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 LLKDGPPVPTRC------QVLGRGAYGTVFKAIYRD------RSVAVKIIRAQAASTLHNES-HL 65
            |..|.|.:|..|      ..||:|.:|.|.|..||.      |..|:|...|...|.|..|: |:
 Worm    29 LTSDIPKIPPNCIDELNSHFLGKGTFGVVEKTKYRKTRDDTYRPAAIKYASATHLSILKREAKHM 93

  Fly    66 LNLEHRNIVRLLKLESAADF-----GLVI--MECPRGQSLQRIVD--TLALPLMHRVLITLDVVA 121
            .||  ||.|.::|:....:.     |||:  |:|  |.....|.|  .:...:.|.......:.:
 Worm    94 WNL--RNHVNIIKIYGMYESHRNGQGLVMEYMDC--GCVADLIYDRKNIEYKMDHVASWMYQLSS 154

  Fly   122 ALRYCHSQNVLHLDVKPTNILVALGTKSSITCNSSKIKVKRSYICKLCDFG--SSIEMGEFCAWQ 184
            |:.:.||::.:|.|:|..|:|::...::                .|:||||  :||.       |
 Worm   155 AVNFFHSKDQIHRDLKLQNMLLSHHHRT----------------LKICDFGTFTSIH-------Q 196

  Fly   185 EPSVAKGTLRYMSPEALRSDTLTEASDIYSLGITMWQLQARRLPYHTLDCNET-IAYQVVKHELR 248
            ..:..:|:...|:||..|.:.....:||:|:||.|||:.||..|| |::...| ..|.|....||
 Worm   197 SMTSNRGSPITMAPEIFRCEPYNMKADIFSIGIIMWQMIARDHPY-TMNMPITPFLYNVATRNLR 260

  Fly   249 PDNYHQLKILA-------LDSP------IDCD-----------------WDLAHESTANVICRRA 283
            |.......||:       .|:|      .||.                 ||.|..::..|...::
 Worm   261 PHEIECNPILSNFYKRCWSDNPASRPTSADCVEYFRCLRSEYPNGNVPLWDPASGASNTVKIPKS 325

  Fly   284 NTSARRNLSLDPSYTVGRDLKKK-----RHRNRLALHFDS---PAPEGSACSESAYSQLYKSCWV 340
            ....|..|.| |...:..|:|.|     :.:...||..|:   |..|....:|....:::.:. :
 Worm   326 QPGGRSPLPL-PKTEITPDVKPKEVAPAKVQETPALLPDTLKVPKVERQISNEEEKQKIFMTA-L 388

  Fly   341 SAPELR--------LSSIQLKHE 355
            |..:.|        .||::|.|:
 Worm   389 SNEDTRPIDPNEGDESSLELYHQ 411

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MosNP_610817.1 STKc_Mos 19..298 CDD:270881 88/333 (26%)
S_TKc 26..257 CDD:214567 71/249 (29%)
Y105C5A.24NP_502888.2 PKc_like 49..287 CDD:389743 75/265 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0192
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.