DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mos and Mos

DIOPT Version :9

Sequence 1:NP_610817.1 Gene:Mos / 36404 FlyBaseID:FBgn0033773 Length:364 Species:Drosophila melanogaster
Sequence 2:NP_064405.2 Gene:Mos / 17451 MGIID:97052 Length:343 Species:Mus musculus


Alignment Length:346 Identity:101/346 - (29%)
Similarity:150/346 - (43%) Gaps:81/346 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 GDLLL-NTPKRKQLLKDGPPVPTR-----------CQV--LGRGAYGTVFKAIYRDRSVAVKII- 51
            |.|.| .||.|      .|.:|.|           |.:  ||.|.:|:|:||.|....||:|.: 
Mouse    35 GKLFLGTTPPR------APGLPRRLAWFSIDWEQVCLMHRLGSGGFGSVYKATYHGVPVAIKQVN 93

  Fly    52 ------RAQAASTLHNESHLLNLEHRNIVRLLKL-----ESAADFGLVIMECPRGQSLQRIV--- 102
                  ||...| ...|.::..|.|.||||::..     |.:...|.:|||.....:|.:::   
Mouse    94 KCTKDLRASQRS-FWAELNIARLRHDNIVRVVAASTRTPEDSNSLGTIIMEFGGNVTLHQVIYGA 157

  Fly   103 ----DTLA----LPLMHRVLITLDVVAALRYCHSQNVLHLDVKPTNILVALGTKSSITCNSSKIK 159
                :.|:    |.|...:..:||||..|.:.|||::||||:||.|||::               
Mouse   158 TRSPEPLSCREQLSLGKCLKYSLDVVNGLLFLHSQSILHLDLKPANILIS--------------- 207

  Fly   160 VKRSYICKLCDFGSSIEMGEF-CAWQEPSVAKGTLRYMSPEALRSDTLTEASDIYSLGITMWQLQ 223
              ...:||:.|||.|.::.:. |....|....||..:.:||.|:.:..|..:||||.|||:||:.
Mouse   208 --EQDVCKISDFGCSQKLQDLRCRQASPHHIGGTYTHQAPEILKGEIATPKADIYSFGITLWQMT 270

  Fly   224 ARRLPYHTLDCNETIAYQVVKHELRPDNYHQLKILALDSPIDCDWDLAHESTANVI--CRRANTS 286
            .|.:||....  :.:.|.||.:.|||.....:...:|..          ::..|:|  |..|...
Mouse   271 TREVPYSGEP--QYVQYAVVAYNLRPSLAGAVFTASLTG----------KTLQNIIQSCWEARAL 323

  Fly   287 ARRNLSLDPSYTVGRDLKKKR 307
            .|....|     :.||||..|
Mouse   324 QRPGAEL-----LQRDLKAFR 339

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MosNP_610817.1 STKc_Mos 19..298 CDD:270881 90/317 (28%)
S_TKc 26..257 CDD:214567 79/256 (31%)
MosNP_064405.2 STKc_Mos 59..335 CDD:270881 86/303 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167834001
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0192
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 109 1.000 Inparanoid score I4884
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0009419
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_109630
Panther 1 1.100 - - LDO PTHR23257
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5036
SonicParanoid 1 1.000 - - X7157
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
109.820

Return to query results.
Submit another query.