DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mos and lrk-1

DIOPT Version :9

Sequence 1:NP_610817.1 Gene:Mos / 36404 FlyBaseID:FBgn0033773 Length:364 Species:Drosophila melanogaster
Sequence 2:NP_492839.4 Gene:lrk-1 / 172995 WormBaseID:WBGene00003068 Length:2393 Species:Caenorhabditis elegans


Alignment Length:421 Identity:92/421 - (21%)
Similarity:159/421 - (37%) Gaps:140/421 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 RCQVLGRGAYGTVFKAIYRDRS-----VAVKIIR------------------------------- 52
            |.::|||||:|.||:|..|..:     ||.|::.                               
 Worm  1696 RSRMLGRGAFGFVFRATVRQPNGELCEVAQKMLEPVDPGPGGRPSALAAYKAAADKWKRDSMEFA 1760

  Fly    53 AQAASTLHNESHLLN-LEHRNIVRLLKLESAADFGLVIMECPRGQSLQRIVDTLALPLMHRVLIT 116
            .:|..|...|..||: ::|.|::.|:.: ......||:...|.| :|.:::.:      ||...|
 Worm  1761 CRAYCTSRQELSLLSRMKHPNVIGLVGV-CTFPLSLVVELAPLG-ALNQLLGS------HRKAGT 1817

  Fly   117 -----------LDVVAALRYCHSQNVLHLDVKPTNILVALGTKSSITCNSSKIKVKRSYICKLCD 170
                       :.|..||.|.||.::::.|:|..|:   ||.:.     .:....:...:.||.|
 Worm  1818 KLSLGVIKESAVQVARALEYLHSAHIIYRDLKSENV---LGWRF-----PAPFSPQTDVLLKLGD 1874

  Fly   171 FGSSIEMGEFCAWQEPS-VAK---GTLRYMSPEALR---SDTLTEASDIYSLGITMWQLQARRLP 228
            :|.|..:       .|| .||   ||..:|:||.:|   .:..|:..|.:|.|:.:::|...:.|
 Worm  1875 YGISRSV-------LPSGGAKGFGGTEGFMAPEIVRFNGEEEYTQKVDCFSFGMFLYELLTLKFP 1932

  Fly   229 YHT--------LDCNETIAYQVVKHELRPDNYHQLKILALDSPIDCDWDLAHESTANVICRRANT 285
            :.:        ||....:   ::.|||      .|....||..:.| |....||       |.::
 Worm  1933 FESEEHVKERMLDGARPV---LLPHEL------LLPTPMLDLLVHC-WSAHPES-------RPSS 1980

  Fly   286 SARRNLSLDPSYT-------VGRDLKKKRHRNRLAL----HFDSPAPEGSACSESAYSQLYKSCW 339
            |........|.:|       :|..|...:   .:|:    ..|.|        :...:||    |
 Worm  1981 SQLVGFCAAPEFTHLLDVCELGEALPPTQ---LMAVGITDEIDDP--------DDFEAQL----W 2030

  Fly   340 VSAPELRL-----------SSIQLKHELEFI 359
            :|..|:.:           .||:|.|..:::
 Worm  2031 LSGREMVVMGCTQYGFVDQKSIELPHRGKYV 2061

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MosNP_610817.1 STKc_Mos 19..298 CDD:270881 77/336 (23%)
S_TKc 26..257 CDD:214567 67/293 (23%)
lrk-1NP_492839.4 Ank_2 29..121 CDD:289560
ANK 51..218 CDD:238125
ANK repeat 56..88 CDD:293786
ANK repeat 90..121 CDD:293786
ANK 192..337 CDD:238125
ANK repeat 197..228 CDD:293786
Ank_2 202..286 CDD:289560
ANK repeat 230..262 CDD:293786
Ank_2 269..390 CDD:289560
ANK 312..456 CDD:238125
ANK repeat 361..390 CDD:293786
Ank_2 366..472 CDD:289560
ANK repeat 398..432 CDD:293786
LRR_RI <512..>639 CDD:238064
leucine-rich repeat 534..555 CDD:275380
LRR_8 554..615 CDD:290566
leucine-rich repeat 556..580 CDD:275380
leucine-rich repeat 581..604 CDD:275380
leucine-rich repeat 605..627 CDD:275380
leucine-rich repeat 628..654 CDD:275380
leucine-rich repeat 655..684 CDD:275380
leucine-rich repeat 687..718 CDD:275380
LRR_8 718..776 CDD:290566
leucine-rich repeat 719..742 CDD:275380
leucine-rich repeat 743..765 CDD:275380
leucine-rich repeat 803..856 CDD:275380
LRR_8 857..915 CDD:290566
leucine-rich repeat 857..883 CDD:275380
leucine-rich repeat 884..906 CDD:275380
leucine-rich repeat 907..931 CDD:275380
P-loop_NTPase 977..1160 CDD:304359
COR <1239..>1336 CDD:292713
S_TKc 1698..1983 CDD:214567 75/324 (23%)
PKc_like 1699..1990 CDD:304357 75/330 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0192
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.