DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mos and mom-4

DIOPT Version :9

Sequence 1:NP_610817.1 Gene:Mos / 36404 FlyBaseID:FBgn0033773 Length:364 Species:Drosophila melanogaster
Sequence 2:NP_492620.1 Gene:mom-4 / 172842 WormBaseID:WBGene00003396 Length:536 Species:Caenorhabditis elegans


Alignment Length:269 Identity:76/269 - (28%)
Similarity:111/269 - (41%) Gaps:55/269 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 DGPPVPTRC------QVLGRGAYGTVFKAIYRD------RSVAVKIIRAQAASTLHNESHLL-NL 68
            |.|.:..:|      ..||:|.||.|.|..||.      |..|:|.......:||..|:.:: :|
 Worm    40 DIPEIQAQCIDNLNSHYLGKGTYGLVEKTRYRKTRQDDFRPAAIKYSSQLHMATLIREAKVMWDL 104

  Fly    69 -EHRNIVRLLKLESAADFG----LVIMECPRGQSLQRIVDTLALPLMHRVLITLDVVA------- 121
             .|.||:::..|..:...|    :..|:|  |.....:.|..      .:..|:|.||       
 Worm   105 RNHPNIIKIYGLYKSPRNGQGVVMEYMDC--GSMADLLYDRT------HINYTIDHVASWMFQLS 161

  Fly   122 -ALRYCHSQNVLHLDVKPTNILVALGTKSSITCNSSKIKVKRSYICKLCDFGSSIEMGEFCAWQE 185
             |:.:.||.:.:|.|:|..|:|::                .|....||||||:...|     .|.
 Worm   162 SAVDFFHSNSQVHRDLKLQNMLLS----------------DRYRTMKLCDFGTFTSM-----HQS 205

  Fly   186 PSVAKGTLRYMSPEALRSDTLTEASDIYSLGITMWQLQARRLPYHTLDCNETIAYQVVKHELRPD 250
            .:..:||...|:||..|.:.....|||||:||.|||:.||..||........:.|.|....|||.
 Worm   206 MTSNRGTPITMAPEVFRCEQYNMKSDIYSIGIIMWQIIARNHPYRRDLSVPGLLYNVATANLRPQ 270

  Fly   251 NYHQLKILA 259
            ......||:
 Worm   271 ELECNPILS 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MosNP_610817.1 STKc_Mos 19..298 CDD:270881 75/267 (28%)
S_TKc 26..257 CDD:214567 71/250 (28%)
mom-4NP_492620.1 PKc_like 57..303 CDD:304357 73/252 (29%)
S_TKc 57..301 CDD:214567 73/252 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0192
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.