DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mos and LOC105945216

DIOPT Version :9

Sequence 1:NP_610817.1 Gene:Mos / 36404 FlyBaseID:FBgn0033773 Length:364 Species:Drosophila melanogaster
Sequence 2:XP_017945240.1 Gene:LOC105945216 / 105945216 -ID:- Length:275 Species:Xenopus tropicalis


Alignment Length:150 Identity:42/150 - (28%)
Similarity:65/150 - (43%) Gaps:36/150 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    90 MECPRGQSLQ-RIVDTLALPLMHRVLITLDVVAALRYCHSQNVLHLDVKPTNILVALGTKSSITC 153
            ||...|.||: .|.....|.:...:..:.:::..|:|.||..::|.|:||.||:  |.::..|  
 Frog    37 MEYASGGSLELEIRKRKHLKMRKVIFYSAEIICGLQYLHSHGIIHRDIKPGNIM--LSSEGHI-- 97

  Fly   154 NSSKIKVKRSYICKLCDFGSSIE--------MGEFCAWQEPSVAKGTLRYMSPEALRSDTLTEAS 210
                         |:.|||.:.|        .|.|          ||..||:||..|....:.|.
 Frog    98 -------------KILDFGLAAEGVYGDSTTNGRF----------GTFAYMAPEVHREKEYSAAV 139

  Fly   211 DIYSLGITMWQLQARRLPYH 230
            |.:|.|||:.|:...:.|:|
 Frog   140 DWWSYGITLCQMATGQYPFH 159

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MosNP_610817.1 STKc_Mos 19..298 CDD:270881 41/149 (28%)
S_TKc 26..257 CDD:214567 41/149 (28%)
LOC105945216XP_017945240.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D420914at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.