DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mos and LOC101732819

DIOPT Version :9

Sequence 1:NP_610817.1 Gene:Mos / 36404 FlyBaseID:FBgn0033773 Length:364 Species:Drosophila melanogaster
Sequence 2:XP_031749696.1 Gene:LOC101732819 / 101732819 -ID:- Length:424 Species:Xenopus tropicalis


Alignment Length:247 Identity:65/247 - (26%)
Similarity:107/247 - (43%) Gaps:52/247 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 RKQLLKDGPPVP--------------TRCQVLGRGAYGTVFKAIY--RDRSVAVKIIRAQAAST- 58
            |:.||:....:|              |..:.||.|..|.|..|.:  :.:.||:||::.:.... 
 Frog    88 REDLLEGKEEIPCGSEKATPLDIQSYTFHRKLGEGTGGKVMLASFAPKKQLVAIKIVQKKPNRCN 152

  Fly    59 ---LHNESHLLN-------LEHRNIVRLLKLESAADFGLVIMECPRGQSLQRIVD-TLALPLMHR 112
               :..|:.||.       |.|.:.....|.::     ..::|...|.:|.|::. ...||....
 Frog   153 YPWIMMEAQLLKFARECPFLCHSHATFQSKAQA-----FFVLEYAGGGTLYRMISRQKTLPTKSI 212

  Fly   113 VLITLDVVAALRYCHSQNVLHLDVKPTNILVALGTKSSITCNSSKIKVKRSYICKLCDFGSSIEM 177
            ...:.::|.||::.|...::|.|:||.||||.         |...||:        ||||.: .:
 Frog   213 QFYSAEMVVALQFLHYNGIIHRDLKPDNILVD---------NDGHIKI--------CDFGIA-AV 259

  Fly   178 GEFCAWQEPSVAKGTLRYMSPEALRSDTLTEASDIYSLGITMWQLQARRLPY 229
            |.|..|:...:| ||..|.:||.|..:....|.|.:|||:.|:::...|||:
 Frog   260 GMFAGWKIRGLA-GTPGYRAPEMLSLEAYDAAVDWWSLGVIMYEMATGRLPF 310

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MosNP_610817.1 STKc_Mos 19..298 CDD:270881 62/239 (26%)
S_TKc 26..257 CDD:214567 60/218 (28%)
LOC101732819XP_031749696.1 PKc_like 119..410 CDD:419665 60/216 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D420914at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.