DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mos and LOC101731396

DIOPT Version :9

Sequence 1:NP_610817.1 Gene:Mos / 36404 FlyBaseID:FBgn0033773 Length:364 Species:Drosophila melanogaster
Sequence 2:XP_004911760.1 Gene:LOC101731396 / 101731396 -ID:- Length:486 Species:Xenopus tropicalis


Alignment Length:265 Identity:74/265 - (27%)
Similarity:113/265 - (42%) Gaps:50/265 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 PKRKQLLKDGP-PVPTR----CQVLGRGAYGTVFKAIY--RDRSVAVKIIRAQAASTLHNESHLL 66
            ||:.::..|.| |:..:    ...|..|.:|.|..|.|  ..:.|||||::.:.     ::|:..
 Frog   156 PKKLRVDTDRPAPLDIKNYRFYSELASGGFGQVMLASYAPTKQLVAVKIMKKKP-----DKSNFA 215

  Fly    67 NLEHRNIVRLLKLESAADF-------------GLVIMECPRGQSLQRIVDTLA-LPLMHRVLITL 117
            .:...  .||||:.....|             ..:|:|...|:||..:::... ||:...:..|.
 Frog   216 IMMKE--ARLLKVARGCTFLCHSYAAFQSELEAFLILEYASGKSLMEMINRKGNLPMGRIMFYTA 278

  Fly   118 DVVAALRYCHSQNVLHLDVKPTNILVALGTKSSITCNSSKIKVKRSYICKLCDFGSSIEMGEFCA 182
            ::|..|::.||:.::|.||||.|.|                 |.|....|:||||.:.| |.|..
 Frog   279 EMVVGLQFLHSKGIVHRDVKPDNTL-----------------VDRDGHIKICDFGLAAE-GIFDE 325

  Fly   183 WQEPSVAKGTLRYMSPEALRSDTLTEASDIYSLGITMWQLQARRLPYHTLDCNETIAYQVVKHEL 247
            .:...|| ||..|.:||.|.........|.:|.||||:|:...|||:..   ..:|..|....|.
 Frog   326 ERTSGVA-GTPGYRAPEVLLKANYNAGVDWWSFGITMYQMATGRLPFSP---TGSIVRQYYAIEK 386

  Fly   248 RPDNY 252
            ...||
 Frog   387 NKPNY 391

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MosNP_610817.1 STKc_Mos 19..298 CDD:270881 71/255 (28%)
S_TKc 26..257 CDD:214567 69/243 (28%)
LOC101731396XP_004911760.1 PKc_like 180..453 CDD:389743 69/241 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D420914at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.