DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mos and mos

DIOPT Version :9

Sequence 1:NP_610817.1 Gene:Mos / 36404 FlyBaseID:FBgn0033773 Length:364 Species:Drosophila melanogaster
Sequence 2:XP_031759862.1 Gene:mos / 100489962 XenbaseID:XB-GENE-1011506 Length:355 Species:Xenopus tropicalis


Alignment Length:377 Identity:95/377 - (25%)
Similarity:150/377 - (39%) Gaps:120/377 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 RKQLLKDGPPVPTRCQV----------LGRGAYGTVFKAIYRDRSVAVKIIRAQAASTLHN---- 61
            |.:||   ||....|.:          :|.|.:|:|::|||:..:||:|.::....::|.:    
 Frog    40 RHRLL---PPRLAWCSIDWEQVRLLEPVGSGGFGSVYRAIYKGETVALKKVKRCTKNSLASRQSF 101

  Fly    62 --ESHLLNLEHRNIVRLLKLESAADF-----GLVIMECPRGQSLQRIVDTLALPLMHRVLI--TL 117
              |.:...|.|.::||:|...::...     |.:|||.....:|...:.....||...|.:  ..
 Frog   102 WAELNAARLRHPHVVRVLAASASCPGDPGCPGTIIMEYAGTDTLHGRIYGRCPPLGAAVCMRYAR 166

  Fly   118 DVVAALRYCHSQNVLHLDVKPTNILVALGTKSSITCNSSKIKVKRSYICKLCDFGSSIEM----- 177
            .|...|.:.|...|:|||:||.|:|:|.|.                 :||:.|||.|..:     
 Frog   167 HVADGLCFLHRDGVVHLDLKPANVLLAPGG-----------------LCKIGDFGCSQRLRDGDS 214

  Fly   178 --GEFCAWQEPSVAKGTLRYMSPEALRSDTLTEASDIYSLGITMWQLQARRLPYHTLDCNETIAY 240
              ||.|..|...|. ||..:.:||.|:.:.:|..:||||..||:||:.:|.||| |.| .:.:.|
 Frog   215 AGGEPCCTQLRHVG-GTYTHRAPELLKGEPVTAKADIYSFAITLWQMVSRELPY-TGD-RQCVLY 276

  Fly   241 QVVKHELRPDNYHQLKILALDSPIDCDWDLAHESTANVICRRANTSARRNLSLDPSYTVGRDLKK 305
            .||.:.|||:                                          :.|.::...:.:.
 Frog   277 AVVAYALRPE------------------------------------------MGPLFSCTEEGRA 299

  Fly   306 KRHRNRLALHFDSPAPEGSACSESAYSQLYKSCWVSAPELRLSSIQLKHELE 357
            .||                         :.:|||.:.||.|.|:.||...||
 Frog   300 VRH-------------------------IVQSCWAARPEERPSAEQLLERLE 326

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MosNP_610817.1 STKc_Mos 19..298 CDD:270881 79/308 (26%)
S_TKc 26..257 CDD:214567 75/260 (29%)
mosXP_031759862.1 STKc_Mos 54..326 CDD:270881 87/358 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D420914at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR23257
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.110

Return to query results.
Submit another query.