DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mos and ankk1

DIOPT Version :9

Sequence 1:NP_610817.1 Gene:Mos / 36404 FlyBaseID:FBgn0033773 Length:364 Species:Drosophila melanogaster
Sequence 2:NP_001124137.1 Gene:ankk1 / 100170831 ZFINID:ZDB-GENE-071015-4 Length:733 Species:Danio rerio


Alignment Length:260 Identity:59/260 - (22%)
Similarity:106/260 - (40%) Gaps:69/260 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 YGTVFKAIYRDRSVAVKIIRAQAA-STLHNESHLLNLEHRNIVRLLKLES------AADFGL--- 87
            :|.|:|       |.:|::|...| .|..|       ::|||:.:.|:..      .:.:|:   
Zfish    40 FGRVYK-------VKLKVLRETCALKTTTN-------DYRNIMEISKIGRMKFNYLISIYGICKD 90

  Fly    88 ---VIMECPRGQSLQRIVDTLALPLMHRVLITLDVVAALRYCHSQN--VLHLDVKPTNILVALGT 147
               ::||..|..||..::....|....:..:..::...:.:.||..  :|||::||.|||:    
Zfish    91 PPALVMEYMRKGSLDNLLSNHLLMWPKKFQMIHEMTMGMNFLHSMKPPILHLNLKPANILL---- 151

  Fly   148 KSSITCNSSKIKVKRSYICKLCDFGSSIEMGEFCAWQ--------EPSVAKGTLRYMSPEALRSD 204
                   ...:.|      |:.|||       |..|:        |..:|:|.:.|:.||.|..:
Zfish   152 -------DDHLHV------KISDFG-------FIKWEFSSKTEFIEHLMARGNINYVPPETLSQN 196

  Fly   205 TLTEAS--DIYSLGITMWQLQARRLPYHTLDCNETIAYQVVKHELRPDNYHQLKILALDSPIDCD 267
            .....:  |:||..|.||::..::..|..|...|.:..  |....||.    ::.:..|.|.:|:
Zfish   197 PEPPGTKYDVYSFSIIMWEILTQKRSYAGLSMTEILIR--VSSGKRPG----VEKIPEDKPPECE 255

  Fly   268  267
            Zfish   256  255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MosNP_610817.1 STKc_Mos 19..298 CDD:270881 59/260 (23%)
S_TKc 26..257 CDD:214567 56/248 (23%)
ankk1NP_001124137.1 PKc_like 32..289 CDD:304357 59/260 (23%)
STYKc 33..276 CDD:214568 59/260 (23%)
ANK repeat 347..378 CDD:293786
Ank_2 352..443 CDD:289560
ANK 375..501 CDD:238125
ANK repeat 381..411 CDD:293786
ANK repeat 413..444 CDD:293786
Ank_2 418..511 CDD:289560
ANK 441..567 CDD:238125
ANK repeat 446..477 CDD:293786
ANK repeat 479..511 CDD:293786
Ank_2 485..576 CDD:289560
ANK 508..629 CDD:238125
ANK repeat 513..544 CDD:293786
ANK repeat 546..576 CDD:293786
Ank_2 551..641 CDD:289560
ANK repeat 581..610 CDD:293786
ANK 607..731 CDD:238125
ANK repeat 612..643 CDD:293786
Ank_2 617..709 CDD:289560
ANK repeat 645..676 CDD:293786
ANK repeat 678..709 CDD:293786
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0192
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.