Sequence 1: | NP_610817.1 | Gene: | Mos / 36404 | FlyBaseID: | FBgn0033773 | Length: | 364 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001124137.1 | Gene: | ankk1 / 100170831 | ZFINID: | ZDB-GENE-071015-4 | Length: | 733 | Species: | Danio rerio |
Alignment Length: | 260 | Identity: | 59/260 - (22%) |
---|---|---|---|
Similarity: | 106/260 - (40%) | Gaps: | 69/260 - (26%) |
- Green bases have known domain annotations that are detailed below.
Fly 33 YGTVFKAIYRDRSVAVKIIRAQAA-STLHNESHLLNLEHRNIVRLLKLES------AADFGL--- 87
Fly 88 ---VIMECPRGQSLQRIVDTLALPLMHRVLITLDVVAALRYCHSQN--VLHLDVKPTNILVALGT 147
Fly 148 KSSITCNSSKIKVKRSYICKLCDFGSSIEMGEFCAWQ--------EPSVAKGTLRYMSPEALRSD 204
Fly 205 TLTEAS--DIYSLGITMWQLQARRLPYHTLDCNETIAYQVVKHELRPDNYHQLKILALDSPIDCD 267
Fly 268 267 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Mos | NP_610817.1 | STKc_Mos | 19..298 | CDD:270881 | 59/260 (23%) |
S_TKc | 26..257 | CDD:214567 | 56/248 (23%) | ||
ankk1 | NP_001124137.1 | PKc_like | 32..289 | CDD:304357 | 59/260 (23%) |
STYKc | 33..276 | CDD:214568 | 59/260 (23%) | ||
ANK repeat | 347..378 | CDD:293786 | |||
Ank_2 | 352..443 | CDD:289560 | |||
ANK | 375..501 | CDD:238125 | |||
ANK repeat | 381..411 | CDD:293786 | |||
ANK repeat | 413..444 | CDD:293786 | |||
Ank_2 | 418..511 | CDD:289560 | |||
ANK | 441..567 | CDD:238125 | |||
ANK repeat | 446..477 | CDD:293786 | |||
ANK repeat | 479..511 | CDD:293786 | |||
Ank_2 | 485..576 | CDD:289560 | |||
ANK | 508..629 | CDD:238125 | |||
ANK repeat | 513..544 | CDD:293786 | |||
ANK repeat | 546..576 | CDD:293786 | |||
Ank_2 | 551..641 | CDD:289560 | |||
ANK repeat | 581..610 | CDD:293786 | |||
ANK | 607..731 | CDD:238125 | |||
ANK repeat | 612..643 | CDD:293786 | |||
Ank_2 | 617..709 | CDD:289560 | |||
ANK repeat | 645..676 | CDD:293786 | |||
ANK repeat | 678..709 | CDD:293786 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E2759_KOG0192 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |