DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wuc and LIN52

DIOPT Version :9

Sequence 1:NP_001097291.1 Gene:wuc / 36401 FlyBaseID:FBgn0033770 Length:136 Species:Drosophila melanogaster
Sequence 2:NP_001358934.1 Gene:LIN52 / 91750 HGNCID:19856 Length:147 Species:Homo sapiens


Alignment Length:110 Identity:25/110 - (22%)
Similarity:44/110 - (40%) Gaps:26/110 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 SPSDEEYTLEEDPIEFELEKMERGSSN-------GESEEESQRDQKQADSIIDDMVEQNDQEQEA 70
            ||:|.. .||...:.|  ||::|.|.:       |.:|..:........|....|.|        
Human     3 SPTDGT-DLEASLLSF--EKLDRASPDLWPEQLPGVAEFAASFKSPITSSPPKWMAE-------- 56

  Fly    71 AGEQDVERENDLRKMYELSLLPPAAIAAQIQQMEKEIYE--LSQW 113
                 :||: |:..:.||..|..|.:..:::.::...|:  |.:|
Human    57 -----IERD-DIDMLKELGSLTTANLMEKVRGLQNLAYQLGLDEW 95

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wucNP_001097291.1 LIN52 <57..127 CDD:287062 12/59 (20%)
LIN52NP_001358934.1 LIN52 14..94 CDD:370793 19/95 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR31489
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
22.060

Return to query results.
Submit another query.