powered by:
Protein Alignment wuc and lin52
DIOPT Version :9
Sequence 1: | NP_001097291.1 |
Gene: | wuc / 36401 |
FlyBaseID: | FBgn0033770 |
Length: | 136 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001071264.1 |
Gene: | lin52 / 777755 |
ZFINID: | ZDB-GENE-061110-82 |
Length: | 112 |
Species: | Danio rerio |
Alignment Length: | 52 |
Identity: | 16/52 - (30%) |
Similarity: | 29/52 - (55%) |
Gaps: | 1/52 - (1%) |
- Green bases have known domain annotations that are detailed below.
Fly 75 DVERENDLRKMYELSLLPPAAIAAQIQQMEKEIYELSQWEARELIRSKHLRI 126
::|.| |:..:.||..|..|.:..:::.::...|:|...|:||:.|.|.|.|
Zfish 56 ELESE-DIEMLKELGSLTTANLMEKVKGLQNLAYQLGLEESREMTRGKFLNI 106
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
wuc | NP_001097291.1 |
LIN52 |
<57..127 |
CDD:287062 |
16/52 (31%) |
lin52 | NP_001071264.1 |
LIN52 |
14..107 |
CDD:287062 |
16/52 (31%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
O |
PTHR31489 |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
1 |
0.960 |
- |
- |
|
|
ZFIN |
0 | 0.000 |
Not matched by this tool. |
|
2 | 2.060 |
|
Return to query results.
Submit another query.