DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wuc and lin52

DIOPT Version :9

Sequence 1:NP_001097291.1 Gene:wuc / 36401 FlyBaseID:FBgn0033770 Length:136 Species:Drosophila melanogaster
Sequence 2:NP_001016782.1 Gene:lin52 / 549536 XenbaseID:XB-GENE-5889227 Length:112 Species:Xenopus tropicalis


Alignment Length:51 Identity:17/51 - (33%)
Similarity:28/51 - (54%) Gaps:1/51 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 EREN-DLRKMYELSLLPPAAIAAQIQQMEKEIYELSQWEARELIRSKHLRI 126
            |.|| |:..:.||..|..|.:..:::.::...|:|...|:||:.|.|.|.|
 Frog    56 ELENDDIDMLKELGSLTTANLMEKVRGLQNLAYQLGLDESREMTRGKFLNI 106

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wucNP_001097291.1 LIN52 <57..127 CDD:287062 17/51 (33%)
lin52NP_001016782.1 LIN52 14..107 CDD:370793 17/51 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR31489
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.