powered by:
Protein Alignment wuc and lin52
DIOPT Version :9
Sequence 1: | NP_001097291.1 |
Gene: | wuc / 36401 |
FlyBaseID: | FBgn0033770 |
Length: | 136 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001016782.1 |
Gene: | lin52 / 549536 |
XenbaseID: | XB-GENE-5889227 |
Length: | 112 |
Species: | Xenopus tropicalis |
Alignment Length: | 51 |
Identity: | 17/51 - (33%) |
Similarity: | 28/51 - (54%) |
Gaps: | 1/51 - (1%) |
- Green bases have known domain annotations that are detailed below.
Fly 77 EREN-DLRKMYELSLLPPAAIAAQIQQMEKEIYELSQWEARELIRSKHLRI 126
|.|| |:..:.||..|..|.:..:::.::...|:|...|:||:.|.|.|.|
Frog 56 ELENDDIDMLKELGSLTTANLMEKVRGLQNLAYQLGLDESREMTRGKFLNI 106
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
wuc | NP_001097291.1 |
LIN52 |
<57..127 |
CDD:287062 |
17/51 (33%) |
lin52 | NP_001016782.1 |
LIN52 |
14..107 |
CDD:370793 |
17/51 (33%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
O |
PTHR31489 |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.100 |
|
Return to query results.
Submit another query.