DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8768 and sdr39u1

DIOPT Version :9

Sequence 1:NP_610813.3 Gene:CG8768 / 36400 FlyBaseID:FBgn0033769 Length:302 Species:Drosophila melanogaster
Sequence 2:NP_001070046.1 Gene:sdr39u1 / 767637 ZFINID:ZDB-GENE-060929-104 Length:301 Species:Danio rerio


Alignment Length:295 Identity:118/295 - (40%)
Similarity:176/295 - (59%) Gaps:8/295 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LIGGGTGFIGRNLANHLTKKGYDVTVISRMPGAKRITWHELEKNGIPGSVNAVVNATGQNTLDPT 75
            :|||||||:||.|...|..||:::|:|||.||..:|||.::|..|:|....| ||..|:|.::|.
Zfish     4 VIGGGTGFVGRELTRLLKSKGHEITLISRQPGPGKITWSDVESRGLPPCEGA-VNLAGENIMNPL 67

  Fly    76 RRWTPGFQQNVWNSRINSSKTLAQAIKSAP-QVSSFVNLCGVSHYKPSESKVYTEEDQVQGFDYM 139
            |.|...::.::::||:|:::.|.|||.::| ...|:|.:.|::.||||....||||.:...||::
Zfish    68 RWWNESYKNDLFSSRVNTTRILTQAIAASPAPPQSWVLVTGIACYKPSLQTHYTEESKWTPFDFL 132

  Fly   140 SRLCLAWEEAAHTGSEQDCKTTILRCGAVVGHGGGMVQSMWLPFKFGVGGPLGNGNQIMPWIHLH 204
            |.|...||.|.....|...||..:....|:|..||.::.|.:||..|:||.||:|.|..||||:.
Zfish   133 SGLVKEWEGAGQLPEESAKKTRQVIVRPVLGRDGGAMKQMLIPFWLGLGGTLGSGRQPFPWIHVS 197

  Fly   205 DLCSLIQYIIE------KPVPGVVNAVAPEITSNLEFSKAFAKALHRPCIFGVPEFVVQAIFGPE 263
            ||..:|.:.:|      ...|.|.|.|||.:.:|.||:|...:.|.||.:|.||.|.:....|.|
Zfish   198 DLAGIIAHALEPREDPPSTEPDVFNGVAPALNTNFEFTKELGRVLKRPTVFPVPGFFLDVCLGSE 262

  Fly   264 RAALVLSGAKVKPQKALSSGFKFQYPSVKEAVTQL 298
            ||.::..|.||.|::.|.|||:||||.:..|:.::
Zfish   263 RAVILTQGQKVLPKRTLDSGFEFQYPDLTSALKEI 297

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8768NP_610813.3 SDR_a8 9..299 CDD:187553 118/295 (40%)
yfcH 10..295 CDD:273800 117/290 (40%)
sdr39u1NP_001070046.1 SDR_a8 2..297 CDD:187553 118/293 (40%)
yfcH 3..294 CDD:273800 117/290 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170589778
Domainoid 1 1.000 126 1.000 Domainoid score I5386
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H69295
Inparanoid 1 1.050 233 1.000 Inparanoid score I3398
OMA 1 1.010 - - QHG62760
OrthoDB 1 1.010 - - D1498565at2759
OrthoFinder 1 1.000 - - FOG0006585
OrthoInspector 1 1.000 - - oto39716
orthoMCL 1 0.900 - - OOG6_104216
Panther 1 1.100 - - LDO PTHR11092
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X4827
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
1312.910

Return to query results.
Submit another query.