DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8768 and SPBC2A9.02

DIOPT Version :9

Sequence 1:NP_610813.3 Gene:CG8768 / 36400 FlyBaseID:FBgn0033769 Length:302 Species:Drosophila melanogaster
Sequence 2:NP_596211.1 Gene:SPBC2A9.02 / 2540401 PomBaseID:SPBC2A9.02 Length:295 Species:Schizosaccharomyces pombe


Alignment Length:267 Identity:59/267 - (22%)
Similarity:92/267 - (34%) Gaps:58/267 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 IGGGTGFIGRNLANHLTKKGYDVTVISRMPGAKRITWHELEKNGIPGSVNAVVNATGQ----NTL 72
            :.|..||||..:...|.:.|::|..:.|.           |:|.      |.:.|.|.    .||
pombe     5 VTGAAGFIGSEIVRQLLEAGHEVVGLVRS-----------EENA------AKLRAAGGTPYIGTL 52

  Fly    73 DPTRRWTPGFQQ-------------NVWNSRINSSKTLAQAI------KSAPQVSSFVNLCGVSH 118
            :.......|..|             :::.........:.:||      ...|.:::     .|:.
pombe    53 EDLDTLKKGVAQCDGVIHTAFVHDFSIYQEACKLDARVIEAIGEVLRGTERPLITT-----SVTA 112

  Fly   119 YKPSESKVYTEEDQVQGFDYMSRLCLAWEEAAHTGSEQDCKTTILRCGAVVGHGGGMVQSMWLPF 183
            ...|..|:.||..:|.......:|   .|......:.|..:.:|||....| ||.|  ...::|.
pombe   113 VLSSNGKLGTEISEVPQPPIPRQL---GEVTTLKFASQGVRASILRLPPTV-HGAG--DHAFVPM 171

  Fly   184 KF------GVGGPLGNGNQIMPWIHLHDLCSLIQYIIEKPVPG-VVNAVAPEITSNLEFSKAFAK 241
            ..      ||...:|||....|.:|..|..:|....:||...| :.:|||.|.....|.:....|
pombe   172 LINVAKNKGVSAYIGNGMNCWPAVHRTDAANLFVLALEKETAGSIYHAVAEEGIPIKEIAGMIGK 236

  Fly   242 ALHRPCI 248
            .|..|.|
pombe   237 RLDIPVI 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8768NP_610813.3 SDR_a8 9..299 CDD:187553 59/267 (22%)
yfcH 10..295 CDD:273800 59/267 (22%)
SPBC2A9.02NP_596211.1 SDR_a7 1..289 CDD:187572 59/267 (22%)
WcaG 1..283 CDD:223528 59/267 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.