DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Obp49a and Obp58c

DIOPT Version :9

Sequence 1:NP_610812.1 Gene:Obp49a / 36399 FlyBaseID:FBgn0050052 Length:212 Species:Drosophila melanogaster
Sequence 2:NP_611710.1 Gene:Obp58c / 37608 FlyBaseID:FBgn0034769 Length:199 Species:Drosophila melanogaster


Alignment Length:185 Identity:40/185 - (21%)
Similarity:68/185 - (36%) Gaps:20/185 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 VDCSKRPSFVNP---KTCCPMPDFVTAELKQKCIKFDMTPPPPPDGEASGSFESKRRHHHPHPPP 85
            :||....: :|.   ..||..||... :|.:.|.:......|..:.||.....:.|...    ..
  Fly    21 IDCENTEA-INEDHIHYCCKHPDGHN-DLIEGCARETNFTLPNQNEEALVDITADRAIR----GT 79

  Fly    86 CFFSCIFNETGIYQNRKLDEAKLNAYLQEVFEDSSDLQTTATQAFTTCATKVADFEANLPPRPAP 150
            ||..|:|::..:.::..||...:.:...|.|.|..:.......||..|..|..:..:....:|. 
  Fly    80 CFGKCVFSKLNLMKDNNLDMDAVRSLFTERFPDDPEYAKEMINAFDHCHGKSEENTSMFLSKPL- 143

  Fly   151 SPPPGF-----PMCPHDAGHLMGCVFRNMMKNCPDSIRNDSQQCTDMKEFFTKCK 200
                 |     ..|...:..::.||.|....|||....:.:::|.|...|..||:
  Fly   144 -----FKQMSKQFCDPKSSVVLACVIRQFFHNCPADRWSKTKECEDTLAFSKKCQ 193

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Obp49aNP_610812.1 None
Obp58cNP_611710.1 PBP_GOBP 47..135 CDD:299791 19/91 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21066
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.