DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Obp49a and Obp58b

DIOPT Version :9

Sequence 1:NP_610812.1 Gene:Obp49a / 36399 FlyBaseID:FBgn0050052 Length:212 Species:Drosophila melanogaster
Sequence 2:NP_611709.1 Gene:Obp58b / 37607 FlyBaseID:FBgn0034768 Length:203 Species:Drosophila melanogaster


Alignment Length:212 Identity:46/212 - (21%)
Similarity:78/212 - (36%) Gaps:27/212 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLSKSQLLLLVVGFCLNAAVSADVDC--SKRPSFVNPKTCCPMPDFVTAELKQKCIKFDMTPPPP 63
            ||....::.:::...||..|:..|.|  .:|....|...||...| ...::.:.|.|......|.
  Fly     1 MLRIGFVICVIISLRLNGLVAVRVHCRHMERIHEENIHHCCKHQD-GHDDVTESCAKQTNFRLPS 64

  Fly    64 PDGEA----------SGSFESKRRHHHPHPPPCFFSCIFNETGIYQNRKLDEAKLNAYLQEVFED 118
            |:.||          .|:              |:..|:|:...:.:|..||..|:.:|.:...:.
  Fly    65 PNEEAIVDVTVDQAMVGT--------------CWAKCVFDHYNLMENNTLDMDKVRSYYKRYHQT 115

  Fly   119 SSDLQTTATQAFTTCATKVADFEANLPPRPAPSPPPGFPMCPHDAGHLMGCVFRNMMKNCPDSIR 183
            ..:..|....|:..|.|:..:........|..........|...:..:|.||..|...|||.|..
  Fly   116 DPEYATEMLNAYEKCHTQSEEATEKFLSLPIVRAFSTAKFCKPTSSIIMSCVIYNFFHNCPASRW 180

  Fly   184 NDSQQCTDMKEFFTKCK 200
            :::.:|.:...|..|||
  Fly   181 SNTTECVETLAFARKCK 197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Obp49aNP_610812.1 None
Obp58bNP_611709.1 PBP_GOBP 52..154 CDD:299791 20/115 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21066
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.