DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Obp49a and Obp59a

DIOPT Version :10

Sequence 1:NP_610812.1 Gene:Obp49a / 36399 FlyBaseID:FBgn0050052 Length:212 Species:Drosophila melanogaster
Sequence 2:NP_788429.1 Gene:Obp59a / 37605 FlyBaseID:FBgn0034766 Length:202 Species:Drosophila melanogaster


Alignment Length:57 Identity:12/57 - (21%)
Similarity:20/57 - (35%) Gaps:5/57 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 RRHHHPHPPPCFFSCIFNETGIYQNRKLDEAKLNAYLQEVFEDSSDLQTTATQAFTT 132
            |.|.......|...|.|.|..:.....:.:.:..:||.     :.||:....:.|.|
  Fly   100 RNHTSNDGGQCVAQCFFEEMNMVDGNGMPDRRKVSYLL-----TKDLRDRELRNFFT 151

Return to query results.
Submit another query.