DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Obp49a and Obp47b

DIOPT Version :9

Sequence 1:NP_610812.1 Gene:Obp49a / 36399 FlyBaseID:FBgn0050052 Length:212 Species:Drosophila melanogaster
Sequence 2:NP_610669.1 Gene:Obp47b / 36207 FlyBaseID:FBgn0033614 Length:199 Species:Drosophila melanogaster


Alignment Length:214 Identity:50/214 - (23%)
Similarity:87/214 - (40%) Gaps:35/214 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 LSKSQLLLLVVGFCLNAAV---SADVDCSKRPSFVNPKTCCPMPDFVTAELKQKCIKFDMTPPPP 63
            :|.||||::.....||..:   .|.:||.:.|..|:|..||  .|....::.::|.:..:   ..
  Fly     1 MSPSQLLVIFASLALNTRLVFGQATIDCQRPPQLVDPALCC--KDGGRDQVAEQCAQRIL---GT 60

  Fly    64 PDGEASGSFESKRRHHHPHPP-----PCFFSCIFNETG-IYQNRKLDEAKLNAYLQEVFEDSSDL 122
            .:|:.:|.           ||     .|...||...:. |.:.:||:.|.:.:.|...|.:.:..
  Fly    61 ANGQKAGG-----------PPSLDTAACLAECILTSSKYIDEPQKLNLANIRSDLSAKFSNDTLY 114

  Fly   123 QTTATQAFTTCATK-------VADFEANLPPRPAPSPPPGFPMCPHDAGHLMGCVFRNMMKNCPD 180
            ..|.|.||:.|..:       :...:..:..:......   |.|...:..::||.:....|||||
  Fly   115 VETMTMAFSKCEPQSQRRLAMIMQQQQQVQQQKTQQQQ---PRCSPFSAIVLGCTYMEYFKNCPD 176

  Fly   181 SIRNDSQQCTDMKEFFTKC 199
            .....:.|||..|.:.|:|
  Fly   177 HRWTPNAQCTLAKAYVTQC 195



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0006725
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.