DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Obp49a and Obp50d

DIOPT Version :9

Sequence 1:NP_610812.1 Gene:Obp49a / 36399 FlyBaseID:FBgn0050052 Length:212 Species:Drosophila melanogaster
Sequence 2:NP_725388.2 Gene:Obp50d / 246436 FlyBaseID:FBgn0050074 Length:173 Species:Drosophila melanogaster


Alignment Length:205 Identity:41/205 - (20%)
Similarity:73/205 - (35%) Gaps:41/205 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLSKSQLLLLVVGFCLNAAVSADVDCSKRPSFVNPKTCCPMPDFVTAELKQKCIKFDMTPPPPPD 65
            ||.|...:|:.:    .|..:||..||:||.....:.||.:|:...:....||.::.:       
  Fly     1 MLHKLTWVLIFI----PAFRAADPICSQRPDVTALRNCCKLPNLDFSSFNSKCSQYLV------- 54

  Fly    66 GEASGSFESKRRHHHPHPPPCFFSCIFNETGIYQNRKLDEAKLNAYLQEVFEDSSDLQTTATQAF 130
                         :..|..||.|.|||..........|....:...::.:. .|.:........|
  Fly    55 -------------NGVHISPCSFECIFRAANALNGTHLVMENIEKMMKTIL-GSDEFVHVYLDGF 105

  Fly   131 TTCATKVADFEANLPPRPAP------SPPPGFPMCPHDAGHLMGCVFRNMMKNCPDSIRNDSQQC 189
            .:|..:.......:..|..|      |....:.:|.|          |.:.:|||:|:.:.|..|
  Fly   106 RSCGNQEKVLIKAMKRRRVPITGKCGSMAIMYGLCAH----------RYVYRNCPESVWSKSATC 160

  Fly   190 TDMKEFFTKC 199
            .:.:|:..:|
  Fly   161 NEAREYSIRC 170



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21066
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.