DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13148 and UTF1

DIOPT Version :10

Sequence 1:NP_610811.1 Gene:CG13148 / 36398 FlyBaseID:FBgn0033767 Length:370 Species:Drosophila melanogaster
Sequence 2:NP_003568.2 Gene:UTF1 / 8433 HGNCID:12634 Length:341 Species:Homo sapiens


Alignment Length:184 Identity:43/184 - (23%)
Similarity:65/184 - (35%) Gaps:33/184 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 GNNVGRGPYERA-WTTEATRALIHIRGPMEGSFTEGRQKRTALW---LHCTRQLQRLGFRYSAAK 111
            |..|..|..:|. |:...|..|:            |...:.|:|   |...||......|.|||.
Human    50 GLPVSPGSAQRTPWSARETELLL------------GTLLQPAVWRALLLDRRQALPTYRRVSAAL 102

  Fly   112 VQKKWHNILITYN---KNLNKKYVSGYVHWE---FFEEMFKYLQGKKADFDMQLPQQTSNAPQAP 170
            .|::.........   |.|..|:..  .|.:   .|:|..:.|.|...|...:.|::.|.....|
Human   103 AQQQVRRTPAQCRRRYKFLKDKFRE--AHGQPPGPFDEQIRKLMGLLGDNGRKRPRRRSPGSGRP 165

  Fly   171 HSANGQNPNPGIPQQPLQLQPTPVSL---KPGTPQMQVQL---PPQTAAKDSQP 218
            ..|....||...| .|.:...||:..   :...|...::.   ||::|  |:.|
Human   166 QRARRPVPNAHAP-APSEPDATPLPTARDRDADPTWTLRFSPSPPKSA--DASP 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13148NP_610811.1 Myb_DNA-bind_4 60..143 CDD:463994 20/92 (22%)
UTF1NP_003568.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..62 4/11 (36%)
Myb_DNA-bind_4 <94..134 CDD:463994 9/41 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 146..273 17/74 (23%)
Leucine-zipper 279..310
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.