DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13148 and emb2746

DIOPT Version :10

Sequence 1:NP_610811.1 Gene:CG13148 / 36398 FlyBaseID:FBgn0033767 Length:370 Species:Drosophila melanogaster
Sequence 2:NP_201147.2 Gene:emb2746 / 836461 AraportID:AT5G63420 Length:911 Species:Arabidopsis thaliana


Alignment Length:150 Identity:37/150 - (24%)
Similarity:59/150 - (39%) Gaps:26/150 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LNAGNGQAPS---NGNNVEDNEP------YQISDDDLDDLDDDCLLEEADTSGAGNNVGRGPYER 61
            :|..:..:||   |.|.|.|.||      ....||:|.|..|      ::|..:...|.:    .
plant   765 INPSSSPSPSETENMNKVADTEPKAEGKENSRDDDELADASD------SETKSSPKRVRK----N 819

  Fly    62 AWTTEATRALIHIRGPMEGSF--TEGRQKRTALWLHCTRQLQRLGFRYSAAKVQKKWHNILITYN 124
            .|..|..:.:|.:||.:...|  .:||.   |||...:..|...|...|..:.:..|.:::..|.
plant   820 KWKPEEIKKVIRMRGELHSRFQVVKGRM---ALWEEISSNLSAEGINRSPGQCKSLWASLIQKYE 881

  Fly   125 KNLNKKYVSGYVHWEFFEEM 144
            :  :|........|..||:|
plant   882 E--SKADERSKTSWPHFEDM 899

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13148NP_610811.1 Myb_DNA-bind_4 60..143 CDD:463994 19/84 (23%)
emb2746NP_201147.2 RnjA 108..664 CDD:440360
GT1 819..884 CDD:213402 16/69 (23%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.