DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nemy and CYB-1

DIOPT Version :9

Sequence 1:NP_725208.1 Gene:nemy / 36395 FlyBaseID:FBgn0261673 Length:290 Species:Drosophila melanogaster
Sequence 2:NP_198679.1 Gene:CYB-1 / 833853 AraportID:AT5G38630 Length:230 Species:Arabidopsis thaliana


Alignment Length:232 Identity:66/232 - (28%)
Similarity:114/232 - (49%) Gaps:25/232 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 YLLIVILSTILLVGVLVLTLFWVMFYRDGFAWSESPKQQ-FNLHPILMIAGFVTLSGFSILIYRL 121
            ::::.:|.  .::..||||  |.:.||.|.|.|...|.. ||:||::|:.|.:..:|.::|.|:.
plant    12 FMVVRVLG--FIIAALVLT--WTVHYRGGLALSSDNKDHIFNVHPVMMVIGLILFNGEAMLAYKS 72

  Fly   122 CRCVKQIYVKLIHMFFHAVAIPCIALGFISVFASHDALHKVNFYSLHSWLGFVTMGMFVLQFVIG 186
            .:..|.: .||:|:.....|.....:|..:....|......||||||||||...:.:|..|:..|
plant    73 VQGTKNL-KKLVHLTLQLTAFILSLIGVWAALKFHIDKGIENFYSLHSWLGLACLFLFAFQWAAG 136

  Fly   187 FFSFLVMLCCENKTYSCRSAMVPIHASLGLANFWLAIATSVTGLIEKERETVNEAGVSSENKLVE 251
            |.::..    ...:.:.|::::|.|..||::.:.||:.|:.||::||       ......|:::.
plant   137 FVTYWY----PGGSRNSRASLMPWHVFLGISIYALALVTATTGILEK-------VTFLQVNQVIT 190

  Fly   252 HYITSA-----IGVTLIFIGIIVTFAVRRSNAPASAK 283
            .|.|.|     :||.::.:|..|...|   ..|.|.|
plant   191 RYSTEAMLVNTMGVLILILGGFVILGV---VTPVSGK 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nemyNP_725208.1 Cytochrom_B561 99..233 CDD:281217 38/133 (29%)
CYB-1NP_198679.1 PLN02680 1..230 CDD:215365 66/232 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1619
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1503869at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm3372
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10106
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X568
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
87.880

Return to query results.
Submit another query.