DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nemy and ACYB-2

DIOPT Version :9

Sequence 1:NP_725208.1 Gene:nemy / 36395 FlyBaseID:FBgn0261673 Length:290 Species:Drosophila melanogaster
Sequence 2:NP_001328918.1 Gene:ACYB-2 / 828662 AraportID:AT4G25570 Length:280 Species:Arabidopsis thaliana


Alignment Length:227 Identity:74/227 - (32%)
Similarity:121/227 - (53%) Gaps:16/227 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 LLIVILSTILLVGVLVLTLFWVMFYRDGFAWSESPKQQ-FNLHPILMIAGFVTLSGFSILIYRLC 122
            :.:..::..|.|...::.|.|.:.||.|.||..:.|.. |||||:||:.||:.|.|.:|:.|:..
plant    49 MAVTFVAHALAVIAAIMVLVWSISYRGGLAWEATNKNLIFNLHPVLMLIGFIILGGEAIISYKSL 113

  Fly   123 RCVKQIYVKLIHMFFHAVAIPCIALGFISVFASHDALHKVNFYSLHSWLGFVTMGMFVLQFVIGF 187
            ...|.: .||||:..||:|:.....|..:.|.:|:..|..|.||||||:|...:.::..|:|   
plant   114 PLEKPV-KKLIHLILHAIALALGIFGICAAFKNHNESHIPNLYSLHSWIGIGVISLYGFQWV--- 174

  Fly   188 FSFLVMLCCENKTYSCRSAMVPIHASLGLANFWLAIATSVTGLIEK----ERETVNEAGVSSENK 248
            :||:|.......| :.:|.::|.||.|||..:.||:..:..|.:||    |...:::.|  ||..
plant   175 YSFIVFFFPGGST-NLKSGLLPWHAMLGLFVYILAVGNAALGFLEKLTFLENGGLDKYG--SEAF 236

  Fly   249 LVEHYITSAIGVTLIFIGIIVTFAVRRSNAPA 280
            |:..   :|| :|::|...:|..|...|.:|:
plant   237 LINF---TAI-ITILFGAFVVLTASAESPSPS 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nemyNP_725208.1 Cytochrom_B561 99..233 CDD:281217 47/133 (35%)
ACYB-2NP_001328918.1 PLN02810 42..280 CDD:178406 74/227 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1619
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1503869at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm3372
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10106
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X568
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
87.880

Return to query results.
Submit another query.