DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nemy and cybrd1

DIOPT Version :9

Sequence 1:NP_725208.1 Gene:nemy / 36395 FlyBaseID:FBgn0261673 Length:290 Species:Drosophila melanogaster
Sequence 2:NP_001018336.1 Gene:cybrd1 / 552960 ZFINID:ZDB-GENE-050522-365 Length:253 Species:Danio rerio


Alignment Length:223 Identity:69/223 - (30%)
Similarity:123/223 - (55%) Gaps:11/223 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 EYLLIVILSTILLVGVLVLTLFWVMFYRDGFAWSESPKQQFNLHPILMIAGFVTLSGFSILIYRL 121
            ::||..||::::.:..:.:.|.||:.||:|..| :....:||.||:||:.||:.|.|.:|::|||
Zfish     6 QFLLFFILASVVGIVSIAVALSWVLHYREGLGW-DGGAAEFNWHPLLMVIGFIFLQGIAIVVYRL 69

  Fly   122 ---CRCVKQIYVKLIHMFFHAVAIPCIALGFISVFASHDALHKVNFYSLHSWLGFVTMGMFVLQF 183
               .||.||: :||||...|.:|.....:..::||..|:|.:..|.||||||:|...:.::..|.
Zfish    70 PWTWRCSKQM-MKLIHAGLHILAFILAVISVVAVFVFHNAKNIPNMYSLHSWVGLAAVVLYPSQI 133

  Fly   184 VIGFFSFLVMLCCENKTYSCRSAMVPIHASLGLANFWLAIATSVTGLIEKERETVNEAGVSSENK 248
            |:|...:|:.:    .....|:|::|:|...||..|...||.::.|:.||...::...  :.::.
Zfish   134 VLGIAVYLIPV----TPVRVRAALMPLHIYSGLFIFISVIAAALMGITEKLIFSLKSP--AYKDS 192

  Fly   249 LVEHYITSAIGVTLIFIGIIVTFAVRRS 276
            ..|..:.:.:|:.:...|.:|.:...||
Zfish   193 PPEAVLVNVLGLLIAAFGALVVWIATRS 220

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nemyNP_725208.1 Cytochrom_B561 99..233 CDD:281217 48/136 (35%)
cybrd1NP_001018336.1 Cyt_b561_CYBRD1 34..186 CDD:176495 54/157 (34%)
Heme b 1 binding. /evidence=ECO:0000250|UniProtKB:Q53TN4 113..116 1/2 (50%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 227..253
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1619
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1503869at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10106
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X568
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
76.880

Return to query results.
Submit another query.