DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nemy and CG1275

DIOPT Version :9

Sequence 1:NP_725208.1 Gene:nemy / 36395 FlyBaseID:FBgn0261673 Length:290 Species:Drosophila melanogaster
Sequence 2:NP_647703.1 Gene:CG1275 / 38286 FlyBaseID:FBgn0035321 Length:340 Species:Drosophila melanogaster


Alignment Length:290 Identity:90/290 - (31%)
Similarity:134/290 - (46%) Gaps:42/290 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 TNSVSP--LPPMEEAMDRVSEKSPPGTP-NGIEM--------PPPPDEKRYEEDPDNAWNCCSWC 56
            ||...|  ..|...|....:|:..|.|. .|||:        .||....:...||       :..
  Fly    46 TNGEKPAAATPATTATPATAEQVQPATTIAGIELATPTAAATSPPTGSGKANMDP-------ALI 103

  Fly    57 EYLLIVILSTILLVGVLVLTLFWVMFYRDGFAWSESPKQQFNLHPILMIAGFVTLSGFSILIYRL 121
            .:.::.:|:.:..:.::||...|:..:..|.|.:.:|..:||.||:.|..||:.|.|.||||||.
  Fly   104 NFKVLYVLTQLCGLTMIVLVATWIGQHFGGLAGTSNPGVEFNWHPLFMTIGFIYLYGNSILIYRG 168

  Fly   122 CRCVKQIYVKLIHMFFHAVAIPCIALGFISVFASHDALHK--VNFYSLHSWLGFVTMGMFVLQFV 184
            .|..::..:||.|...|..|.....:...:||.||:..:.  .|.||||||||...:.:|.||:|
  Fly   169 FRTTRKKTLKLTHAGIHMGAFILTVIALKTVFDSHNLANPPIPNMYSLHSWLGLSAVIVFSLQYV 233

  Fly   185 IGFFSFLVMLCCENKTYSCRSAMVPIHASLGLANFWLAIATSVTGLIEK--------ERETVNEA 241
            .||.:||.....||    .|.||:|:|...||..|.||||:::.|:.||        ...|:..|
  Fly   234 AGFVAFLAPGLREN----YRIAMMPLHIYFGLFGFVLAIASALMGITEKAIFAIKTPAYSTLPPA 294

  Fly   242 GVSSENKLVEHYITSAIGVTLIFIGIIVTF 271
            ||          :.:.|||..:..|.:|.:
  Fly   295 GV----------LANVIGVMYVVFGALVVY 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nemyNP_725208.1 Cytochrom_B561 99..233 CDD:281217 55/135 (41%)
CG1275NP_647703.1 Cyt_b561_CG1275_like 120..336 CDD:176494 74/209 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449104
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1619
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1503869at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10106
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X568
65.850

Return to query results.
Submit another query.