DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nemy and Cyb561

DIOPT Version :9

Sequence 1:NP_725208.1 Gene:nemy / 36395 FlyBaseID:FBgn0261673 Length:290 Species:Drosophila melanogaster
Sequence 2:NP_001100526.1 Gene:Cyb561 / 303601 RGDID:1310987 Length:250 Species:Rattus norvegicus


Alignment Length:231 Identity:67/231 - (29%)
Similarity:112/231 - (48%) Gaps:25/231 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 VILSTILLVGVLVLTLFWVMFYRDGFAWSESPKQQFNLHPILMIAGFVTLSGFSILIYRLCRCVK 126
            |..|.:|.:.|:.:|..|:..||.|.||..|  .|||:||:.|:.|.:.|.|.::|:||:.|...
  Rat    16 VAFSQLLGLTVVAVTGAWLGLYRGGIAWESS--LQFNVHPLCMVMGMIFLQGDALLVYRVFRKEA 78

  Fly   127 QIYVKLIHMFFHAVAIPCIALGFISVFASHDALHKVNFYSLHSWLGFVTMGMFVLQFVIGFFSFL 191
            :...|::|...|..|.....:|.::||..|......:.||||||.|.....::.:|:::||..||
  Rat    79 KRTTKILHGLLHIFAFIIALVGLVAVFDYHKKKGYADLYSLHSWCGISVFVLYFMQWLVGFSFFL 143

  Fly   192 VMLCCENKTYSCRSAMVPIHASLGLANFWLAIATSVTGLIE-------KERETVNEAGVSSENKL 249
            .    ...::|.||...|.|...|...|.|::.|::.||.|       .:..|....||      
  Rat   144 F----PGASFSLRSRYRPQHTFFGATIFLLSVGTALLGLKEALLFKLGSKYSTFEPEGV------ 198

  Fly   250 VEHYITSAIGVTLIFIGIIVTFAVRRSN--APASAK 283
                :.:.:|:.||..|::|.:.:.:::  .|..|:
  Rat   199 ----LANVLGLLLICFGVVVLYILAQADWKRPTQAE 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nemyNP_725208.1 Cytochrom_B561 99..233 CDD:281217 42/140 (30%)
Cyb561NP_001100526.1 Cytochrome_b_N 43..184 CDD:419966 47/146 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1619
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1503869at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10106
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X568
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
76.880

Return to query results.
Submit another query.