DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nemy and Cyb561a3

DIOPT Version :9

Sequence 1:NP_725208.1 Gene:nemy / 36395 FlyBaseID:FBgn0261673 Length:290 Species:Drosophila melanogaster
Sequence 2:XP_006527001.1 Gene:Cyb561a3 / 225912 MGIID:2686925 Length:276 Species:Mus musculus


Alignment Length:226 Identity:68/226 - (30%)
Similarity:116/226 - (51%) Gaps:16/226 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 YLLIVILSTILLVGVLVLTLFWVMFYRDGFAWSESPKQQFNLHPILMIAGFVTLSGFSILIYRLC 122
            ||..::|.::..:.:| .|.:|:.::|.|||| :.....||.||:||:||.|.|.|.:.|:||| 
Mouse     7 YLSCMVLGSLGSMCIL-FTAYWMQYWRGGFAW-DGTVLMFNWHPVLMVAGMVVLYGAASLVYRL- 68

  Fly   123 RCVKQIYV------KLIHMFFHAVAIPCIALGFISVFASHDALHKVNFYSLHSWLGFVTMGMFVL 181
               ...:|      |::|...|.:|..|..:|.|:||..|:.....:.||||||||..|:.:|..
Mouse    69 ---PSSWVGPRLPWKVLHAALHLLAFTCTVVGLIAVFRFHNHSRIAHLYSLHSWLGITTVVLFAC 130

  Fly   182 QFVIGFFSFLVMLCCENKTYSCRSAMVPIHASLGLANFWLAIATSVTGLIEKERETVNEAGVSSE 246
            |:.:||..||:....:    ..||.:.|:|...|.....|:|.:.::|:.||....:..|.....
Mouse   131 QWFLGFAVFLLPWASQ----WLRSLLKPLHVFFGACILSLSITSVISGINEKLFFVLKNATKPYS 191

  Fly   247 NKLVEHYITSAIGVTLIFIGIIVTFAVRRSN 277
            :...|....::.|:.::..|::|.:.:..|:
Mouse   192 SLPGEAVFANSTGLLVVAFGLLVLYVLLASS 222

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nemyNP_725208.1 Cytochrom_B561 99..233 CDD:281217 47/139 (34%)
Cyb561a3XP_006527001.1 Cytochrome_b_N 10..188 CDD:390046 61/187 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1619
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1503869at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10106
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X568
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
76.880

Return to query results.
Submit another query.