DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nemy and F39G3.5

DIOPT Version :9

Sequence 1:NP_725208.1 Gene:nemy / 36395 FlyBaseID:FBgn0261673 Length:290 Species:Drosophila melanogaster
Sequence 2:NP_001023900.1 Gene:F39G3.5 / 178863 WormBaseID:WBGene00018210 Length:251 Species:Caenorhabditis elegans


Alignment Length:248 Identity:70/248 - (28%)
Similarity:120/248 - (48%) Gaps:40/248 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 VILSTILLVGVLVLTL--FWVMFYRDGFAWSESPKQQFN---------LHPILMIAGFVTLSGFS 115
            :|||....||.:.:.|  :::..:::|.||....|...|         ||..|||..|:...|.:
 Worm    18 IILSITHFVGFITICLNGYFLNTFKNGLAWPSKVKNGDNKALGKRGDQLHAFLMILAFIYFQGEA 82

  Fly   116 ILIYRLCRCVKQIYVKLIHMFFHAVAIPCIALGF----ISVFASHDALHKVNFYSLHSWLGFVTM 176
            :|.|||.|...:|..||:|...|.:|   |.||.    :.:.::::|... ||.|:|||:|...:
 Worm    83 LLAYRLYRYDAKIISKLLHTALHIIA---IGLGITALTVIIMSTNNAGWN-NFTSVHSWIGICLL 143

  Fly   177 GMFVLQFVIGFFSFLVMLC-CENKTYSCRSAMVPIHASLGLANFWLAIATSVTG----LIEKERE 236
            .::::||..||.::   || |....|  |:.::|||.::|:..|.:|......|    |:|.:..
 Worm   144 SVYLVQFSFGFLTY---LCPCSPGKY--RARLMPIHRAVGVGCFIVACVQCCLGYGNILLEDQPG 203

  Fly   237 TVNEAGVSSENKLVEHYITSAIGV------TLIFIGIIVTFAVRRSNAPASAK 283
            ..::  :|.:|::  .|: .|..|      ||:.:.:|:....||...|...|
 Worm   204 CFSD--LSCKNRI--EYV-GAFSVMFIILYTLLVLALIIPVPWRREKTPDELK 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nemyNP_725208.1 Cytochrom_B561 99..233 CDD:281217 46/142 (32%)
F39G3.5NP_001023900.1 B561 66..193 CDD:214769 44/135 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160159316
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG28776
OrthoDB 1 1.010 - - D1503869at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10106
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.960

Return to query results.
Submit another query.