powered by:
Protein Alignment nemy and glna-1
DIOPT Version :9
Sequence 1: | NP_725208.1 |
Gene: | nemy / 36395 |
FlyBaseID: | FBgn0261673 |
Length: | 290 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001293582.1 |
Gene: | glna-1 / 175130 |
WormBaseID: | WBGene00007480 |
Length: | 856 |
Species: | Caenorhabditis elegans |
Alignment Length: | 70 |
Identity: | 16/70 - (22%) |
Similarity: | 32/70 - (45%) |
Gaps: | 11/70 - (15%) |
- Green bases have known domain annotations that are detailed below.
Fly 192 VMLCCENKTYSCRSA-MVPIHASLGLANFWLAIATSVTGL------IEKERETVNEA-GVSSENK 248
:|..|....||.:.| .|.:.|..|::...:.:..:|.|: ::| |.|.. ||:...:
Worm 455 LMYSCGMYDYSGKFAFQVGLPAKSGVSGIMIVVIPNVMGIALYSPPLDK---TGNSCRGVAFCRQ 516
Fly 249 LVEHY 253
|::.:
Worm 517 LIDKF 521
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
1 |
0.950 |
- |
0.798795 |
Normalized mean entropy |
S2869 |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.950 |
|
Return to query results.
Submit another query.