DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nemy and glna-1

DIOPT Version :9

Sequence 1:NP_725208.1 Gene:nemy / 36395 FlyBaseID:FBgn0261673 Length:290 Species:Drosophila melanogaster
Sequence 2:NP_001293582.1 Gene:glna-1 / 175130 WormBaseID:WBGene00007480 Length:856 Species:Caenorhabditis elegans


Alignment Length:70 Identity:16/70 - (22%)
Similarity:32/70 - (45%) Gaps:11/70 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   192 VMLCCENKTYSCRSA-MVPIHASLGLANFWLAIATSVTGL------IEKERETVNEA-GVSSENK 248
            :|..|....||.:.| .|.:.|..|::...:.:..:|.|:      ::|   |.|.. ||:...:
 Worm   455 LMYSCGMYDYSGKFAFQVGLPAKSGVSGIMIVVIPNVMGIALYSPPLDK---TGNSCRGVAFCRQ 516

  Fly   249 LVEHY 253
            |::.:
 Worm   517 LIDKF 521

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nemyNP_725208.1 Cytochrom_B561 99..233 CDD:281217 10/47 (21%)
glna-1NP_001293582.1 EF-hand_14 124..211 CDD:375448
Glutaminase 233..526 CDD:377427 16/70 (23%)
Ank_2 556..637 CDD:372319
ANK repeat 583..615 CDD:293786
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0.798795 Normalized mean entropy S2869
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.950

Return to query results.
Submit another query.