DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8646 and Arsk

DIOPT Version :9

Sequence 1:NP_610807.3 Gene:CG8646 / 36394 FlyBaseID:FBgn0033763 Length:562 Species:Drosophila melanogaster
Sequence 2:NP_084123.2 Gene:Arsk / 77041 MGIID:1924291 Length:556 Species:Mus musculus


Alignment Length:595 Identity:117/595 - (19%)
Similarity:194/595 - (32%) Gaps:225/595 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LLLPIIDAAEVEKSPA------------KPNIIFILADDLGFNDVGFHGSAEIPTPNIDAL-AYS 60
            |||..:.||....:||            .||::.:.:|..........||..:..|.|:.: |:.
Mouse     6 LLLVSVVAALALAAPAPRTQKKRMQVNQAPNVVLVASDSFDGRLTFQPGSQVVKLPFINFMRAHG 70

  Fly    61 GIILNRYYVAPICTPSRSALMTGKYPIHTGMQHTVLYAAEPRGLPLEEKILPQY------LNELG 119
            ...||.|..:|||.|||:|:.:|.:...|...:..      :||.      |.|      :.:.|
Mouse    71 TTFLNAYTNSPICCPSRAAMWSGLFTHLTESWNNF------KGLD------PNYTTWMDIMEKHG 123

  Fly   120 YTSHIAGKWHLGHWKLKYTPLYRGFSSHVGFWS----------GHQDYN-----DHTAVENNQWG 169
            |.:...|       |:.||..:...|:.|..|:          |....|     :...|....| 
Mouse   124 YQTQKFG-------KVDYTSGHHSISNRVEAWTRDVAFLLRQEGRPIINLIPDKNRRRVMTKDW- 180

  Fly   170 LDMRNGTQVAYDLHGHYTTDVITDHSVKVIANHNATKGPLFLYVAHAACHSSNPYNPLPVPDN-- 232
               :|                 ||.:::.:...|.|| |..||:      ..|..:|.|.|.:  
Mouse   181 ---QN-----------------TDKAIEWLRQVNYTK-PFVLYL------GLNLPHPYPSPSSGE 218

  Fly   233 -------------------DVIKM----------------------------SHIPNYKRRKFAA 250
                               |.||:                            :.|.|. |..:.|
Mouse   219 NFGSSTFHTSLYWLEKVAYDAIKIPKWLTLSQMHPVDFYSSYTKNCTGKFTENEIKNI-RAFYYA 282

  Fly   251 MVSKMDNSVGQIVDQLRKSNMLENSIIIFSSDNGGPAQGFNLNFASNYPLKGVKNTLWEGGVRAA 315
            |.::.|..:|:|:..|.|.::|:.:|:|::||:|..|......:         |.:::|..|...
Mouse   283 MCAETDAMLGEIILALHKLDLLQKTIVIYTSDHGEMAMEHRQFY---------KMSMYEASVHVP 338

  Fly   316 GLMWSPLLKKSQRVSNQTMHIIDWLPTLLEAAGGQPALSNLSKQIDGQSIWRALVQDKASPRLNV 380
            .||..|.:|.:.:|.: .:.::|..||:|:.||     ..|...:.|.|:...|....|:.:...
Mouse   339 LLMMGPGIKANLQVPS-VVSLVDIYPTMLDIAG-----IALPPNLSGYSLLTLLSNASANEQAFK 397

  Fly   381 LHN----IDDIWGSAA------LSVGDWKLVKGTNYRGSWDGWYGPAGERDPRLYDWQLVGRSRA 435
            .|.    :.:..|..|      |..|.||.:.           |.......|:|:|..|      
Mouse   398 FHRPPWILSEFHGCNANASTYMLRTGQWKYIA-----------YADGASVQPQLFDLSL------ 445

  Fly   436 GKALEALKMLPSRADQQRIRAAATVSCPGQSSQGTSCVATAFSAPCLFHIRDDPCEQYNLAKQYP 500
                                                                ||.|..|:|.::|
Mouse   446 ----------------------------------------------------DPDELTNIATEFP 458

  Fly   501 EVVNALMTEL 510
            |:..:|..:|
Mouse   459 EITYSLDQKL 468

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8646NP_610807.3 AslA 25..459 CDD:225661 101/514 (20%)
4-S 26..405 CDD:293753 96/459 (21%)
DUF4976 <462..531 CDD:303608 9/49 (18%)
ArskNP_084123.2 AslA 34..455 CDD:225661 105/552 (19%)
ARSK 35..448 CDD:293781 102/544 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3119
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.