DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8646 and ids

DIOPT Version :9

Sequence 1:NP_610807.3 Gene:CG8646 / 36394 FlyBaseID:FBgn0033763 Length:562 Species:Drosophila melanogaster
Sequence 2:NP_001073537.1 Gene:ids / 559959 ZFINID:ZDB-GENE-061215-37 Length:561 Species:Danio rerio


Alignment Length:448 Identity:94/448 - (20%)
Similarity:161/448 - (35%) Gaps:150/448 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 WFLWLICLLLPIIDAAEVEKSPAKPNIIFILADDLGFNDVGFHGSAEIPTPNIDALAYSGIIL-N 65
            ||:::..||...:.||:.:..    |:::::||||. ..:|.:....:.:||||.||...::. |
Zfish    11 WFVFIFHLLGRDVFAAKSKNF----NVLYLIADDLR-PTLGCYSDPVVKSPNIDQLASLSVVFHN 70

  Fly    66 RYYVAPICTPSRSALMTGKYP-------------IHTGMQHTVLYAAEPRGLPLEEKILPQYLNE 117
            .|....:|.|||.:.:|.:.|             :|.|...|                ||||...
Zfish    71 AYAQQAVCGPSRVSFLTSRRPDTTKLYDFNSYWRVHAGNYTT----------------LPQYFKS 119

  Fly   118 LGYTSHIAGKWHLGHWKLKYTPLYRGFSSHVGFWSGHQDYNDHTAVENNQWGLDMRNGTQVAYD- 181
            .|||:...||                 ..|.|..|.|.|...::      |.:...:.....|: 
Zfish   120 NGYTTLSVGK-----------------VFHPGIASNHSDDYPYS------WSVPPYHPPSFEYEK 161

  Fly   182 ----------LHGHYTTDV--------------ITDHSVKVIANHNATKGPLFLYVAHAACH--- 219
                      ||.:....|              .|:.:::::.:...::.|.||.|.....|   
Zfish   162 RKVCKDKDGTLHSNLLCPVNVSEMPLGTLPDMENTEEAIRLLRSMKGSQKPFFLSVGFYKPHIPF 226

  Fly   220 -----------------SSNPYNPLPVPD------NDVIKMSHI----------PNYK------R 245
                             :.:|..|..:||      .|:.|...:          |..|      |
Zfish   227 RIPQEYLKLYPIENMTLAPDPDVPKKLPDVAYNPWTDIRKREDVQALNLSFPYGPIPKDFQLRIR 291

  Fly   246 RKFAAMVSKMDNSVGQIVDQLRKSNMLENSIIIFSSDNGGP-------AQGFNLNFASNYPLKGV 303
            :.:.|.||.:|..||:|:..|....:.:|:|::.|||:|..       |:..|.:.|:..||   
Zfish   292 QHYFASVSYVDAQVGKILQTLDDVGLAKNTIVVLSSDHGWSLGEHGEWAKYSNFDVATRVPL--- 353

  Fly   304 KNTLWEGGVRA----AGLMWSPLLKKSQ---------RVSNQTMHIIDWLPTLLEAAG 348
              .:::.||.:    .|....|.:...|         ::.|..:.::|..|||...||
Zfish   354 --MVYKAGVSSRRSRPGAKTFPFIDVFQDTREHFGKGKIVNSVVELLDVFPTLANLAG 409

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8646NP_610807.3 AslA 25..459 CDD:225661 88/425 (21%)
4-S 26..405 CDD:293753 88/424 (21%)
DUF4976 <462..531 CDD:303608
idsNP_001073537.1 iduronate-2-sulfatase 29..527 CDD:293754 88/430 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3119
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.