DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8646 and SULF2

DIOPT Version :9

Sequence 1:NP_610807.3 Gene:CG8646 / 36394 FlyBaseID:FBgn0033763 Length:562 Species:Drosophila melanogaster
Sequence 2:NP_001373981.1 Gene:SULF2 / 55959 HGNCID:20392 Length:871 Species:Homo sapiens


Alignment Length:519 Identity:127/519 - (24%)
Similarity:208/519 - (40%) Gaps:126/519 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 KPNIIFILADDLGFNDVGFHGSAEIPTPNIDALAYSGI-ILNRYYVAPICTPSRSALMTGKYPIH 88
            :||||.:|.||   .||.. ||.::.......:...|. .:|.:...|:|.||||:::|||| :|
Human    43 RPNIILVLTDD---QDVEL-GSMQVMNKTRRIMEQGGAHFINAFVTTPMCCPSRSSILTGKY-VH 102

  Fly    89 TGMQHTVLYAAEPRGLPL-----EEKILPQYLNELGYTSHIAGKWHLGHWKLKYTPLYRGFSSHV 148
               .|......|....|.     |.:....|||..||.:...|| :|..:...|.|  .|:...|
Human   103 ---NHNTYTNNENCSSPSWQAQHESRTFAVYLNSTGYRTAFFGK-YLNEYNGSYVP--PGWKEWV 161

  Fly   149 GFWSGHQDYNDHTAVENNQWGLDMRNGTQVAYDLHGHYTTDVITDHSVK---------------V 198
            |.....:.|| :|...|   |:..::|:..:.|    |.||:||:.||.               :
Human   162 GLLKNSRFYN-YTLCRN---GVKEKHGSDYSKD----YLTDLITNDSVSFFRTSKKMYPHRPVLM 218

  Fly   199 IANHNATKGP---------LFLYVAHAACHSSNPYNPLPVPDNDVI-------KMSHI--PNYKR 245
            :.:|.|..||         ||   .:|:.|.:..||..|.||...|       |..|:  .|..:
Human   219 VISHAAPHGPEDSAPQYSRLF---PNASQHITPSYNYAPNPDKHWIMRYTGPMKPIHMEFTNMLQ 280

  Fly   246 RKFAAMVSKMDNSVGQIVDQLRKSNMLENSIIIFSSDNGGPAQGFNLNFASNYPLKGVKNTLWEG 310
            ||....:..:|:|:..|.:.|.::..|:|:.|::::|:|.....|.|       :|| |:..:|.
Human   281 RKRLQTLMSVDDSMETIYNMLVETGELDNTYIVYTADHGYHIGQFGL-------VKG-KSMPYEF 337

  Fly   311 GVRAAGLMWSPLLKKSQRVSNQTM--HI---IDWLPTLLEAAGGQPALSNLSKQIDGQSIWRALV 370
            .:|.      |...:...|....:  ||   ||..||:|:.||     .::...:||:||.:.|.
Human   338 DIRV------PFYVRGPNVEAGCLNPHIVLNIDLAPTILDIAG-----LDIPADMDGKSILKLLD 391

  Fly   371 QDKASPRLN------------------VLHNIDD--IWGSAALSVGDWKLVKGTNYRGSWDGWYG 415
            .::...|.:                  :||..|:  :.......:..::.||....|..:.....
Human   392 TERPVNRFHLKKKMRVWRDSFLVERGKLLHKRDNDKVDAQEENFLPKYQRVKDLCQRAEYQTACE 456

  Fly   416 PAGERDPRLYDWQLV----GRSRAGKALEALKMLPSRADQQRIRAAATVSCP---GQSSQGTSC 472
            ..|::      ||.|    |:.:..|....:::..|||....:        |   ||.|:..:|
Human   457 QLGQK------WQCVEDATGKLKLHKCKGPMRLGGSRALSNLV--------PKYYGQGSEACTC 506

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8646NP_610807.3 AslA 25..459 CDD:225661 122/501 (24%)
4-S 26..405 CDD:293753 112/442 (25%)
DUF4976 <462..531 CDD:303608 5/14 (36%)
SULF2NP_001373981.1 G6S 43..385 CDD:293766 103/382 (27%)
DUF3740 529..662 CDD:403667
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 560..588
ALP_like <750..799 CDD:419962
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3119
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.