DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8646 and Arsk

DIOPT Version :9

Sequence 1:NP_610807.3 Gene:CG8646 / 36394 FlyBaseID:FBgn0033763 Length:562 Species:Drosophila melanogaster
Sequence 2:NP_001041382.1 Gene:Arsk / 365619 RGDID:1310182 Length:563 Species:Rattus norvegicus


Alignment Length:645 Identity:127/645 - (19%)
Similarity:210/645 - (32%) Gaps:248/645 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LICLLLPIIDAAEVEKSP----------AKPNIIFILADDLGFNDVGFHGSAEIPTPNIDALAYS 60
            |:.|:..|:..|.|..:|          ..||::.:.:|..........||..:..|.|:.:...
  Rat     2 LLLLVSVIVALALVAPAPETQEKRLQVAQAPNVVLVASDSFDGRLTFQPGSQVVKLPFINFMRAR 66

  Fly    61 G-IILNRYYVAPICTPSRSALMTGKYPIHTGMQHTVLYAAEPRGLPLEEKILPQY------LNEL 118
            | ..||.|..:|||.|||:|:.:|.:...|...:..      :||.      |.|      :.:.
  Rat    67 GTTFLNAYTNSPICCPSRAAMWSGLFTHLTESWNNF------KGLD------PNYTTWMDVMEKH 119

  Fly   119 GYTSHIAGKWHLGHWKLKYTPLYRGFSSHVGFWS----------GHQDYN-----DHTAVENNQW 168
            ||.:...|       ||.|:..:...|:.|..|:          |....|     :...|.:..|
  Rat   120 GYQTQKFG-------KLDYSSGHHSISNRVEAWTRDVAFLLRQEGRPIINLIPDKNRRRVMDKDW 177

  Fly   169 GLDMRNGTQVAYDLHGHYTTDVITDHSVKVIANHNATKGPLFLYVAHAACHSSNPYNPLPVPDN- 232
                :|                 ||.::..:...|:|| |..||:      ..|..:|.|.|.: 
  Rat   178 ----QN-----------------TDKAIAWLRQVNSTK-PFVLYL------GLNLPHPYPSPSSG 214

  Fly   233 --------------------DVIK------------MSHIPNYKRR---KFA------------A 250
                                |.||            :.:..:|.:.   ||.            |
  Rat   215 ENFGSSTFHTSLYWLEKVAYDAIKIPKWLALSEMHPVDYYSSYTKNCTGKFTENEIKNIRAFYYA 279

  Fly   251 MVSKMDNSVGQIVDQLRKSNMLENSIIIFSSDNGGPAQGFNLNFASNYPLKGVKNTLWEGGVRAA 315
            |.::.|..:|:|:..|.|.|:|:.:|:|::||:|..|......:         |.:::|......
  Rat   280 MCAETDAMLGEIILALHKLNLLQKTIVIYTSDHGEMAMEHRQFY---------KMSMYEASAHVP 335

  Fly   316 GLMWSPLLKKSQRVSNQTMHIIDWLPTLLEAAGGQPALSNLSKQIDGQSIWRALVQDKASPRLNV 380
            .||..|.:|.:.:|.: .:.::|..||:|:.| |.|...|||    |.|:........|:.:...
  Rat   336 ILMMGPGIKANLQVPS-LVSLVDIYPTMLDIA-GIPLPLNLS----GYSLLPLSSNTSANDQAFR 394

  Fly   381 LHN----IDDIWGSAA------LSVGDWKLVKGTNYRGSWDGWYGPAGERDPRLYDWQLVGRSRA 435
            :|:    :.:..|..|      |..|.||.:.           |.......|:|:|..|      
  Rat   395 VHHPPWILSEFHGCNANASTYMLRTGQWKYIA-----------YSDGTLVQPQLFDLSL------ 442

  Fly   436 GKALEALKMLPSRADQQRIRAAATVSCPGQSSQGTSCVATAFSAPCLFHIRDDPCEQYNLAKQYP 500
                                                                ||.|..|:|.::|
  Rat   443 ----------------------------------------------------DPDELTNIATEFP 455

  Fly   501 EVVNALMTEL-------------ERFN---------ATAVPPSNKPADPRADPRFWNYTW 538
            |:..:|..:|             .|:|         :.|...||..|..|     |:..|
  Rat   456 EITYSLDQQLRSVINYPKVSASVHRYNKEQFIMWKQSVAQNYSNYIAHLR-----WHQDW 510

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8646NP_610807.3 AslA 25..459 CDD:225661 103/513 (20%)
4-S 26..405 CDD:293753 98/458 (21%)
DUF4976 <462..531 CDD:303608 16/90 (18%)
ArskNP_001041382.1 ARSK 32..445 CDD:293781 104/543 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3119
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.