DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8646 and CG18278

DIOPT Version :9

Sequence 1:NP_610807.3 Gene:CG8646 / 36394 FlyBaseID:FBgn0033763 Length:562 Species:Drosophila melanogaster
Sequence 2:NP_725289.1 Gene:CG18278 / 36487 FlyBaseID:FBgn0033836 Length:492 Species:Drosophila melanogaster


Alignment Length:532 Identity:124/532 - (23%)
Similarity:205/532 - (38%) Gaps:120/532 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LICLLLPIIDAAEVEKSPAKPNIIFILADDLGFNDVGFHGSAEIPTPN-IDALAYSGIIL-NRYY 68
            ||.|:|..:.....||   .|||:.||:||   .||...|.  .|..: |:.|.:.|.:. |.|.
  Fly     7 LIILVLACLGNTASEK---LPNILLILSDD---QDVELRGM--FPMEHTIEMLGFGGALFHNAYT 63

  Fly    69 VAPICTPSRSALMTGKYPIHTGMQHTVL----------YAAEPRGLPLEEKILPQYLNELGYTSH 123
            .:|||.|:|::|:||.|..:.|.::..:          .|.|||.||.   ||.|:    ||.:.
  Fly    64 PSPICCPARTSLLTGMYAHNHGTRNNSVSGGCYGPHWRRALEPRALPY---ILQQH----GYNTF 121

  Fly   124 IAGKWHLGHWKLKYTPLYRGFSSHVGFWSGHQDYNDHTAVENNQWGLDMRNGTQVAYDLHGHYTT 188
            ..||:...:|.....|  :|::...|. .|:..|.::|..||:         ..|.|:  ..|.|
  Fly   122 FGGKYLNQYWGAGDVP--KGWNHFYGL-HGNSRYYNYTLRENS---------GNVHYE--STYLT 172

  Fly   189 DVITDHSVKVIANHNATKGPLFLYVAHAACHSSNPYNPLP-------------VPDNDVIKMS-- 238
            |::.|.:...:.|...:..|.|..||..|.|  .|:.|.|             .|..:.:|..  
  Fly   173 DLLRDRAADFLRNATQSSEPFFAMVAPPAAH--EPFTPAPRHEGVFSHIEALRTPSFNQVKQDKH 235

  Fly   239 -------HIPN--------YKRRKFAAMVSKMDNSVGQIVDQLRKSNMLENSIIIFSSDNGGPAQ 288
                   .:||        |.::::..::: :|..|..::..|..:..|||:.||::||||....
  Fly   236 WLVRAARRLPNETINTIDTYFQKRWETLLA-VDELVVTLMGVLNDTQSLENTYIIYTSDNGYHVG 299

  Fly   289 GFNLNFASNYPLKGVKNTLWEGGVRAAGLMWSPLLKKSQRVSNQTMHIIDWLPTLLEAAGGQPAL 353
            .|...|....|        :|..:....|:..|.:.....: :..:.::|..||:|..|.     
  Fly   300 QFAQPFDKRQP--------YETDINVPLLIRGPGIAPESHI-DTAVSLVDLAPTILAWAD----- 350

  Fly   354 SNLSKQIDGQSIWRALVQDKASPRLNVLHNIDDIWGSAALSVGD----W----KLVKGT-----N 405
            .:....:||||....|:..:..........:.:.||...|:..:    |    :|.:.|     :
  Fly   351 IDTPSYMDGQSFHELLLNKRRRVPFFERSLLIEYWGEGTLATFNPECPWPEKDRLAQCTPAADCH 415

  Fly   406 YRGSWDGWYG---PAGERDPRL-------------YDWQLVGRSRAGKALEALKMLPSRADQQRI 454
            .:.:|:..|.   ....|:.|:             ||.||........|.:   :||.......:
  Fly   416 CQDAWNNTYACLRNIRHREDRIYCEFRDNENFLEAYDLQLDPFQMTNIAYD---LLPIERALYSL 477

  Fly   455 RAAATVSCPGQS 466
            |......|.|.|
  Fly   478 RLKNLTQCSGHS 489

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8646NP_610807.3 AslA 25..459 CDD:225661 115/504 (23%)
4-S 26..405 CDD:293753 103/433 (24%)
DUF4976 <462..531 CDD:303608 3/5 (60%)
CG18278NP_725289.1 G6S 24..467 CDD:293766 112/488 (23%)
AslA 24..464 CDD:225661 111/482 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3119
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.