DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8646 and Arsj

DIOPT Version :9

Sequence 1:NP_610807.3 Gene:CG8646 / 36394 FlyBaseID:FBgn0033763 Length:562 Species:Drosophila melanogaster
Sequence 2:NP_001041352.1 Gene:Arsj / 311013 RGDID:1307640 Length:597 Species:Rattus norvegicus


Alignment Length:551 Identity:214/551 - (38%)
Similarity:291/551 - (52%) Gaps:88/551 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 AEVEKSP-------AKPNIIFILADDLGFNDVGFHGSAEIPTPNIDALAYSGIILNRYYVAPICT 74
            |:||:.|       ::|::|||||||.||.|||:||| ||.||.:|.||..|:.|..|||.||||
  Rat    58 AQVEERPEAGTAVTSQPHLIFILADDQGFRDVGYHGS-EIKTPTLDKLAAEGVKLENYYVQPICT 121

  Fly    75 PSRSALMTGKYPIHTGMQHTVLYAAEPRGLPLEEKILPQYLNELGYTSHIAGKWHLGHWKLKYTP 139
            ||||..:||||.||||:||:::...:|..|||:...|||.|.|:||::|:.||||||.::....|
  Rat   122 PSRSQFITGKYQIHTGLQHSIIRPTQPNCLPLDNATLPQKLKEVGYSTHMVGKWHLGFYRKDCMP 186

  Fly   140 LYRGFSSHVGFWSGHQDYNDHTAVEN-NQWGLDMRNGTQVAYDL-HGHYTTDVITDHSVKVIANH 202
            ..|||.:..|...|..||..|...:: ...|.|:......|:|. :|.|:|.:.|....:::|:|
  Rat   187 TKRGFDTFFGSLLGSGDYYTHYKCDSPGVCGYDLYENDNAAWDYDNGIYSTQMYTQRVQQILASH 251

  Fly   203 NATKGPLFLYVAHAACHSSNPYNPLPVPDNDVIKMSHIPNYKRRKFAAMVSKMDNSVGQIVDQLR 267
            :.|| |||||||:.|.||     ||..|.........|.|..||::|||:|.:|.::..:...|:
  Rat   252 DPTK-PLFLYVAYQAVHS-----PLQAPGRYFEHYRSIININRRRYAAMLSCLDEAIHNVTLALK 310

  Fly   268 KSNMLENSIIIFSSDNGG-PAQGFNLNFASNYPLKGVKNTLWEGGVRAAGLMWSPLLKKSQRVSN 331
            :.....|||||:|||||| |..|     .||:||:|.|.|.||||:||.|.:.|||||....|..
  Rat   311 RYGFYNNSIIIYSSDNGGQPTAG-----GSNWPLRGSKGTYWEGGIRAVGFVHSPLLKNKGTVCK 370

  Fly   332 QTMHIIDWLPTLLEAAGGQPALSNLSKQIDGQSIWRALVQDKASPRLNVLHNID----------- 385
            :.:||.||.|||:..|.||   .:...|:||..||..:.:...|||:::|||||           
  Rat   371 ELVHITDWYPTLISLAEGQ---IDEDIQLDGYDIWETISEGLRSPRVDILHNIDPIYTKAKNGSW 432

  Fly   386 ----DIWGSA---ALSVGDWKLVKGTNYRGSWDGWYGPAGERDPRLYDWQLVGRSRAGKALEALK 443
                .||.:|   |:.|..|||:.|                 :|...||         ...:|..
  Rat   433 AAGYGIWNTAIQSAIRVQHWKLLTG-----------------NPGYSDW---------VPPQAFS 471

  Fly   444 ML-PSRADQQRIRAAATVSCPGQSSQGTSCVATAFSAPCLFHIRDDPCEQYNLAKQYPEVVNALM 507
            .| |:|...:||..          |.|.|.        .||:|..||.|:.:|:.:||.:|..|:
  Rat   472 NLGPNRWHNERITL----------STGKSI--------WLFNITADPYERVDLSSRYPGIVKKLL 518

  Fly   508 TELERFNATAVPPSNKPADPRADPRFWNYTW 538
            ..|.:||.||||....|.|||::||.....|
  Rat   519 RRLSQFNKTAVPVRYPPKDPRSNPRLNGGVW 549

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8646NP_610807.3 AslA 25..459 CDD:225661 182/455 (40%)
4-S 26..405 CDD:293753 173/399 (43%)
DUF4976 <462..531 CDD:303608 25/68 (37%)
ArsjNP_001041352.1 AslA 71..507 CDD:225661 191/494 (39%)
4-S 74..507 CDD:293753 191/491 (39%)
DUF4976 <493..>531 CDD:303608 17/37 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D375140at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.