DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8646 and GNS

DIOPT Version :9

Sequence 1:NP_610807.3 Gene:CG8646 / 36394 FlyBaseID:FBgn0033763 Length:562 Species:Drosophila melanogaster
Sequence 2:NP_002067.1 Gene:GNS / 2799 HGNCID:4422 Length:552 Species:Homo sapiens


Alignment Length:578 Identity:135/578 - (23%)
Similarity:226/578 - (39%) Gaps:160/578 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 KPNIIFILADDLGFNDVGFHGSAEIPTPNIDAL-AYSGIILNRYYV-APICTPSRSALMTGKYPI 87
            :||::.:|.||   .|....|..  |.....|| ...|:..:..|| :.:|.|||::::||||| 
Human    46 RPNVVLLLTDD---QDEVLGGMT--PLKKTKALIGEMGMTFSSAYVPSALCCPSRASILTGKYP- 104

  Fly    88 HTGMQHTVLYAAEPRGLP------LEEKILPQYLNEL-GYTSHIAGKWHLGHW------KLKYTP 139
            |.  .|.|....|.....      .|....|..|..: ||.:..||| :|..:      .|::.|
Human   105 HN--HHVVNNTLEGNCSSKSWQKIQEPNTFPAILRSMCGYQTFFAGK-YLNEYGAPDAGGLEHVP 166

  Fly   140 LYRGFSSHVGFW---SGHQDYNDHTAVENNQWGLDMRNGTQVAYDLHGHYTTDVITDHSVKVIAN 201
            |  |:|    :|   ..:..|.::|...|   |...::|...:.|    |.|||:.:.|:..: :
Human   167 L--GWS----YWYALEKNSKYYNYTLSIN---GKARKHGENYSVD----YLTDVLANVSLDFL-D 217

  Fly   202 HNATKGPLFLYVAHAACHSSNPYNPLP----------VPDND-----------VIKMSHIP---- 241
            :.:...|.|:.:|..|.||  |:...|          .|.|.           :|:.:..|    
Human   218 YKSNFEPFFMMIATPAPHS--PWTAAPQYQKAFQNVFAPRNKNFNIHGTNKHWLIRQAKTPMTNS 280

  Fly   242 ------NYKRRKFAAMVSKMDNSVGQIVDQLRKSNMLENSIIIFSSDNGGPAQGFNLNFASNYPL 300
                  |..|:::..::| :|:.|.::|.:|..:..|.|:.|.::||||.....|:|      |:
Human   281 SIQFLDNAFRKRWQTLLS-VDDLVEKLVKRLEFTGELNNTYIFYTSDNGYHTGQFSL------PI 338

  Fly   301 KGVKNTLWEGGVRAAGLMWSPLLKKSQRVSNQTMHIIDWLPTLLEAAGGQPALSNLSK-QIDGQS 364
            .  |..|:|..::...|:..|.:|.:| .|...:..||..||:|:.||     .:|:| |:||.|
Human   339 D--KRQLYEFDIKVPLLVRGPGIKPNQ-TSKMLVANIDLGPTILDIAG-----YDLNKTQMDGMS 395

  Fly   365 IWRALVQDKASPRLNVLHNIDDIWGSAALSVGDWKLVKGTNYRGSWDGWYGPAGERDPRLYDWQL 429
            :            |.:|....::                     :|         |...|.::|.
Human   396 L------------LPILRGASNL---------------------TW---------RSDVLVEYQG 418

  Fly   430 VGRSRAGKALEALKMLPSRADQQRIRAAATVSCPGQSSQGTSCVATAFSA-----PC-------- 481
            .||:.......:|....|:.....:       |....:...:||.| .||     .|        
Human   419 EGRNVTDPTCPSLSPGVSQCFPDCV-------CEDAYNNTYACVRT-MSALWNLQYCEFDDQEVF 475

  Fly   482 --LFHIRDDPCEQYNLAKQY-PEVVNALMTELERFNATAVPPSNKPA--DP--RADPR 532
              ::::..||.:..|:||.. ||::..:...|....:.:.|....|.  ||  |.|||
Human   476 VEVYNLTADPDQITNIAKTIDPELLGKMNYRLMMLQSCSGPTCRTPGVFDPGYRFDPR 533

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8646NP_610807.3 AslA 25..459 CDD:225661 112/483 (23%)
4-S 26..405 CDD:293753 104/428 (24%)
DUF4976 <462..531 CDD:303608 20/88 (23%)
GNSNP_002067.1 G6S 46..495 CDD:293766 124/538 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3119
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.