DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8646 and ARSG

DIOPT Version :10

Sequence 1:NP_610807.3 Gene:CG8646 / 36394 FlyBaseID:FBgn0033763 Length:562 Species:Drosophila melanogaster
Sequence 2:XP_011522838.1 Gene:ARSG / 22901 HGNCID:24102 Length:552 Species:Homo sapiens


Alignment Length:69 Identity:17/69 - (24%)
Similarity:25/69 - (36%) Gaps:15/69 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 RPRWTQLSNRRLINYGGVP------HPK------GMIAEDIPVW-LHHYVERINQLNVYAEGIKA 90
            :.||  .|.:.|...||.|      .||      |.:.|....| |....:::....|.|..:..
Human    30 KKRW--WSFKCLSGEGGKPENESDLRPKSIQRSSGNLEEGRATWKLTGKDDKLGVTGVLALWVLV 92

  Fly    91 NHVL 94
            .||:
Human    93 THVM 96

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8646NP_610807.3 4-S 26..405 CDD:293753 17/69 (25%)
DUF4976 <480..510 CDD:419068
ARSGXP_011522838.1 ARSG 35..496 CDD:293780 15/62 (24%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.