DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ZnT49B and AT2G47830

DIOPT Version :9

Sequence 1:NP_725207.1 Gene:ZnT49B / 36393 FlyBaseID:FBgn0033762 Length:660 Species:Drosophila melanogaster
Sequence 2:NP_182304.2 Gene:AT2G47830 / 819395 AraportID:AT2G47830 Length:471 Species:Arabidopsis thaliana


Alignment Length:384 Identity:87/384 - (22%)
Similarity:143/384 - (37%) Gaps:137/384 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   323 KESEKSGQVVATA-IAINAANLLFKAGGWLYSGSHSMFAEVIHSLADLINQLILAFGIYKSSQSP 386
            :|.||..::..|| |.::.|..|   .|:| .||.::.|:..||::|::...: |...|:::..|
plant    71 EEGEKIFRLGLTADIGLSVAKAL---TGYL-CGSTAIIADAAHSVSDVVLSGV-ALVSYRAANVP 130

  Fly   387 -DIDHPYGYMNMRYVSSLISGVGIFCVGCG--------LSI-------------YHGIDGILHPE 429
             |.:||||:.....:.:|.....:...|.|        |||             :|||| :.|| 
plant   131 KDKEHPYGHGKFETLGALGISAMLLATGSGIAWHALDLLSIALSAAPEVIHSGHHHGID-MNHP- 193

  Fly   430 PITDLFWVYCILMGSL-VSEGATLVVAINELKRSAKENNMSFKDYVISGKDPCVNVVLCEDAAAV 493
                 .....:.:.|: :.||...:.     ||:.::..                          
plant   194 -----ILALTVTIASISIKEGLYWIT-----KRAGEKQG-------------------------- 222

  Fly   494 TGVMVAAACMGLSSYTGSPIFDAAGSLVI-----GALLGA-----VASFIIYT---NAN------ 539
            :|:|:|.|....|        ||..|||.     |::||.     :|..::.|   ||.      
plant   223 SGLMMANAWHHRS--------DAISSLVALVGVGGSILGVNFLDPLAGLVVSTMIVNAGLKTGHQ 279

  Fly   540 ---ALVGISIASERLEKINSALEADVMIRAIYDVKGIDIGNARVRYKAELDFDGRELTRS-YLDK 600
               .||..:|.:::||.|.         :.|..|:|:. |..|:|        ||....| |||.
plant   280 SILELVDAAIPAQQLEPIR---------QTILQVEGVK-GCHRLR--------GRRAGSSLYLDV 326

  Fly   601 QDLAKLLTTVRGFQKVEDLESFLLDQGENIVDLMGGEIDRIEMNLRTQFPEIRHVDLEI 659
            ..:....::|....:|                   ||..|.::||  ..||:..|.:.|
plant   327 HIVVDPFSSVSVAHEV-------------------GEYVRRQINL--NHPEVSEVFIHI 364

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ZnT49BNP_725207.1 Cation_efflux 343..542 CDD:279834 51/243 (21%)
AT2G47830NP_182304.2 FieF 72..367 CDD:223131 87/383 (23%)
Cation_efflux 86..285 CDD:279834 52/249 (21%)
ZT_dimer 294..366 CDD:293521 26/110 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0053
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D667718at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.