DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ZnT49B and ZK185.5

DIOPT Version :10

Sequence 1:NP_725207.1 Gene:ZnT49B / 36393 FlyBaseID:FBgn0033762 Length:660 Species:Drosophila melanogaster
Sequence 2:NP_001033463.1 Gene:ZK185.5 / 3896818 WormBaseID:WBGene00044481 Length:352 Species:Caenorhabditis elegans


Alignment Length:36 Identity:8/36 - (22%)
Similarity:20/36 - (55%) Gaps:5/36 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 ALIGIGLS-VVGLTNYYRKDADNRRYKLTYVVMRPD 66
            |::.:|:. :.|::....|.:.|    :.:|:.:||
 Worm    69 AMLKLGMKPITGVSRVTVKKSKN----ILFVISKPD 100

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ZnT49BNP_725207.1 NTD_ZNT9 214..307 CDD:410964
FieF 343..655 CDD:439823
ZK185.5NP_001033463.1 FieF 92..345 CDD:439823 3/9 (33%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.