DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ZnT49B and ZK185.5

DIOPT Version :9

Sequence 1:NP_725207.1 Gene:ZnT49B / 36393 FlyBaseID:FBgn0033762 Length:660 Species:Drosophila melanogaster
Sequence 2:NP_001033463.1 Gene:ZK185.5 / 3896818 WormBaseID:WBGene00044481 Length:352 Species:Caenorhabditis elegans


Alignment Length:360 Identity:72/360 - (20%)
Similarity:136/360 - (37%) Gaps:100/360 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   235 ESLPKIKRRSPYEQEPPMTVYWRRDVEAKAVEVWGSKENL-LRERLKREVERKQY-------QQI 291
            |.||.|.|:||.:       |:.             .||: ..|:::|:..:|:|       .|:
 Worm     5 ELLPLISRKSPVK-------YYH-------------NENISFFEKMRRQKSKKEYYSRLEKLNQL 49

  Fly   292 YDSADLFTVKRRLRDYRREMGSRTKVM--LDNRKESEKSGQ--VVATAIAINAANLLFKAGGWLY 352
            |:..|                   |::  :...:|.|:|..  :...:||:|...|.......:.
 Worm    50 YEEDD-------------------KLLEGITQPEEHEQSTDRWLANISIALNLTLLFTNLLASIL 95

  Fly   353 SGSHSMFAEVIHSLADLINQLILAFGIYKSSQSPDIDHPYGYMNMRYVSSLISGVGIFCVGCGLS 417
            |||.|:.:..:.||.|:.:.||:...:.....:...::|.|...:..|..:|..: :..:...|.
 Worm    96 SGSLSIVSTFVDSLMDVTSGLIIGICLKLIRNTNMFNYPRGRNRLELVGVIICSI-LMGISNTLL 159

  Fly   418 IYHGIDGILHPE--PITDLFWVYCILMGSLVSEGATLVVAINELKRSAKENNMSFKDYVISGKDP 480
            :...|..||..:  |:.::..:..:|.||.|.    :::.:...||.:..               
 Worm   160 VMESIRSILEGDINPVMNITTISIMLGGSAVK----IILCLICYKRGSSS--------------- 205

  Fly   481 CVNVVLCEDA---AAVTGVMVAAACMGLSSYTGSPIFDAAGSLVI---------GALLGAVASFI 533
              ::||..|.   .|.:.|.:..|.:|...:   |..|..|::::         |..:|.|..  
 Worm   206 --SIVLAMDMRNDIATSIVAIICATVGDRYW---PYADPLGAILVCGVIATSWYGHAIGHVPH-- 263

  Fly   534 IYTNANALVGISIASERLEKI-NSALEADVMIRAI 567
                   |||....||:|.:| ...:|.|..|:.:
 Worm   264 -------LVGRRAESEKLSRILKIVIEHDERIKYV 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ZnT49BNP_725207.1 Cation_efflux 343..542 CDD:279834 38/212 (18%)
ZK185.5NP_001033463.1 FieF 72..343 CDD:357667 51/254 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0053
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.