DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ZnT49B and SPCC1020.03

DIOPT Version :9

Sequence 1:NP_725207.1 Gene:ZnT49B / 36393 FlyBaseID:FBgn0033762 Length:660 Species:Drosophila melanogaster
Sequence 2:NP_001342724.1 Gene:SPCC1020.03 / 2539150 PomBaseID:SPCC1020.03 Length:397 Species:Schizosaccharomyces pombe


Alignment Length:279 Identity:54/279 - (19%)
Similarity:96/279 - (34%) Gaps:73/279 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   298 FTVKRRLRDYRREMGSRT--------KVMLDNRKESEKSGQVVATAIA-----INAANLLFKAGG 349
            |.::..:|  ...:||.|        |.||:..|..:|.|:.....:|     .|......|..|
pombe    32 FEIRNAVR--MHSVGSHTHTHDHGSDKEMLELVKALKKEGKSPELKLAWLGLYSNIGLAAAKGIG 94

  Fly   350 WLYSGSHSMFAEVIHSLADLINQLILAFGIYKSSQSPDIDHPYGY-----MNMRYVSSLISGVGI 409
            .:...|..:.|:..|.|.|.::.|:....:...|:.|...:|.|:     :....||.|:..|.:
pombe    95 GVALQSSILVADAAHQLGDTLSDLVTLATLKICSKKPTQKYPAGFGKWETIGTFTVSGLLVAVSV 159

  Fly   410 FCVGCGLS-IY-----------------HGIDGILHPEPITDLFWVYCILMGSLVSEGATLVVAI 456
            ......|| :|                 |....:|...|    |....::.||:|     |...:
pombe   160 GIAHSSLSRLYTILFPYAGSEHTHIGHSHNPSQLLFEHP----FMALGLIFGSVV-----LKEWL 215

  Fly   457 NELKRSAKENNMSFKDYVISGKDPCVNVVLC----EDAAAVTGVMVAAACMGLSSYTGSPIFDAA 517
            ....|:..:...|             |::|.    ..|.|:|| ||:...:..:.:..:|..|  
pombe   216 FRKTRTVAQKTDS-------------NILLANAWHHRADALTG-MVSLLALSGTYFLNAPWLD-- 264

  Fly   518 GSLVIGALLGAVASFIIYT 536
                  ...|.:.|.::::
pombe   265 ------PFFGCLVSIVVFS 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ZnT49BNP_725207.1 Cation_efflux 343..542 CDD:279834 41/221 (19%)
SPCC1020.03NP_001342724.1 FieF 63..381 CDD:223131 46/246 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0053
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2191
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.930

Return to query results.
Submit another query.