DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8778 and Hadha

DIOPT Version :9

Sequence 1:NP_610805.1 Gene:CG8778 / 36392 FlyBaseID:FBgn0033761 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_849209.1 Gene:Hadha / 97212 MGIID:2135593 Length:763 Species:Mus musculus


Alignment Length:310 Identity:95/310 - (30%)
Similarity:151/310 - (48%) Gaps:57/310 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 LVASRNLASAAPYG---------------DGTEVLVERLD---GARQGISVIGLNRPAAK-NSFS 64
            :||||.:.|.:.:.               ..:..|:.|..   |.:..::||.:|.|.:| |:.:
Mouse     1 MVASRAIGSLSRFSAFRILRSRGCICRSFTTSSALLTRTHINYGVKGDVAVIRINSPNSKVNTLN 65

  Fly    65 RGMVETFNDVLEDIKKDNGSRVVVLRSLSPGIFCAGADLKERKG-MTPEEATEFVKELRGLLIAI 128
            :.:...|.:|:.:|..::..|..||.|..||.|.||||:..... .||:|||...:|.:.:...:
Mouse    66 KEVQSEFIEVMNEIWANDQIRSAVLISSKPGCFVAGADINMLSSCTTPQEATRISQEGQRMFEKL 130

  Fly   129 EQLPMPVIAAVDGAALGGGLEMALACDIRTAASDTK--MGLVETRLAIIPGAGGTQRLPRILSPA 191
            |:.|.||:||:.|:.||||||:|:||..|.|..|.|  :|:.|..|.|:||||||||||:::...
Mouse   131 EKSPKPVVAAISGSCLGGGLELAIACQYRIATKDRKTVLGVPEVLLGILPGAGGTQRLPKMVGVP 195

  Fly   192 LAKELIFTARVFNGAEAKDLGLVNHVV-------KQNETQDAAYQQALKLAEEILPNGPVGVRMA 249
            .|.:::.|.|......||.:|||:.:|       |..|      ::.::..||:..|...|:...
Mouse   196 AAFDMMLTGRNIRADRAKKMGLVDQLVEPLGPGIKSPE------ERTIEYLEEVAVNFAKGLADR 254

  Fly   250 KLAI--DKGMQVDLATGYSIEEICYSQVIPTKDRLEGLAAFAEKRKPVYK 297
            |::.  .||:...|.|        |:..:|          |.  |:.|||
Mouse   255 KVSAKQSKGLVEKLTT--------YAMTVP----------FV--RQQVYK 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8778NP_610805.1 crotonase-like 48..299 CDD:304874 87/263 (33%)
HadhaNP_849209.1 fa_ox_alpha_mit 27..762 CDD:131494 90/284 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.