DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8778 and CDY2A

DIOPT Version :9

Sequence 1:NP_610805.1 Gene:CG8778 / 36392 FlyBaseID:FBgn0033761 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_004816.1 Gene:CDY2A / 9426 HGNCID:1810 Length:541 Species:Homo sapiens


Alignment Length:311 Identity:63/311 - (20%)
Similarity:118/311 - (37%) Gaps:36/311 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSMLIKRASGLARQL-----ARPLVAS-----RNLASAAPYGDGTEVLVERLDGARQGISVIGLN 55
            |...:.|..|..|.:     .:|.:..     |...||..|.|   ::|::.||..|   ::...
Human   244 MHTSVPRVKGGQRNITDDSRGQPFIKKMHFTIRLTESAITYRD---IVVKKEDGFTQ---IVLST 302

  Fly    56 RPAAKNSFS----RGMVETFNDVLEDIKKDNGSRVVVLRSLSPGIFCAGAD----LKERKGMTPE 112
            |...||:.:    :.||...|....|..|      :||.|.:..:||.|.|    ::..:.....
Human   303 RSTEKNALNTEVIKEMVNALNSAAADDSK------LVLFSAAGSVFCCGLDFGYFVRHLRNDRNT 361

  Fly   113 EATEFVKELRGLLIAIEQLPMPVIAAVDGAALGGGLEMALACDIRTAASDTKMGLVETRLAIIPG 177
            .:.|.|..::..:....|...|::.:|:|.|:|.|..:...||:..|..........|.....|.
Human   362 ASLEMVDTIKNFVNTFIQFKKPIVVSVNGPAIGLGASILPLCDLVWANEKAWFQTPYTTFGQSPD 426

  Fly   178 AGGTQRLPRILSPALAKELIFTARVFNGAEAKDLGLVNHV-VKQNETQDAAYQQALKLAEEILPN 241
            ...:...|:::..|.|.|::...|.....||...|||:.| :....||:...|     .:|:...
Human   427 GCSSITFPKMMGKASANEMLIAGRKLTAREACAKGLVSQVFLTGTFTQEVMIQ-----IKELASY 486

  Fly   242 GPVGVRMAKLAIDKGMQVDLATGYSIEEICYSQVIPTKDRLEGLAAFAEKR 292
            ..:.:...|..:...::::|......|.....::..:...:|.:..:.|.:
Human   487 NAIVLEECKALVRCNIKLELEQANERECEVLRKIWSSAQGIESMLKYVENK 537

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8778NP_610805.1 crotonase-like 48..299 CDD:304874 49/254 (19%)
CDY2ANP_004816.1 CHROMO 5..58 CDD:214605
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 72..104
crotonase-like 287..483 CDD:119339 47/209 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165148284
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.