DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8778 and CDYL

DIOPT Version :9

Sequence 1:NP_610805.1 Gene:CG8778 / 36392 FlyBaseID:FBgn0033761 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_001355054.1 Gene:CDYL / 9425 HGNCID:1811 Length:598 Species:Homo sapiens


Alignment Length:247 Identity:58/247 - (23%)
Similarity:102/247 - (41%) Gaps:24/247 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 RNLASAAPYGDGTEVLVERLDGARQGISVIGLNRPAAKNSFSRGMVETFNDVLEDIKKDNGSRVV 87
            |...||..|.|   ::|.:.||...   ::...:.:..||.:..::......|.....|: |::|
Human   333 RQTESAYRYRD---IVVRKQDGFTH---ILLSTKSSENNSLNPEVMREVQSALSTAAADD-SKLV 390

  Fly    88 VLRSLSPGIFCAGADL--------KERKGMTPEEATEFVKELRGLLIAIEQLPMPVIAAVDGAAL 144
            :|.::. .:||.|.|.        .:||    .|:|:..:.:|..:....|...|:|.||:|.|:
Human   391 LLSAVG-SVFCCGLDFIYFIRRLTDDRK----RESTKMAEAIRNFVNTFIQFKKPIIVAVNGPAI 450

  Fly   145 GGGLEMALACDIRTAASDTKMGLVETRLAIIPGAGGTQRLPRILSPALAKELIFTARVFNGAEAK 209
            |.|..:...||:..|..........|.....|....|...|:|:..|.|.|::.:.|.....||.
Human   451 GLGASILPLCDVVWANEKAWFQTPYTTFGQSPDGCSTVMFPKIMGGASANEMLLSGRKLTAQEAC 515

  Fly   210 DLGLVNHVVKQNETQDAAYQQALKLAEEILPNGPVGVRMAKLAIDKGMQVDL 261
            ..|||:.|.    ......|:.:...:|:....||.:..:|..:...|:::|
Human   516 GKGLVSQVF----WPGTFTQEVMVRIKELASCNPVVLEESKALVRCNMKMEL 563

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8778NP_610805.1 crotonase-like 48..299 CDD:304874 50/222 (23%)
CDYLNP_001355054.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..76
Interaction with EZH2. /evidence=ECO:0000269|PubMed:22009739 61..309
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 112..149
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 204..226
Acetyl-CoA-binding domain. /evidence=ECO:0000255 362..594 50/212 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165148286
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.