DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8778 and Echs1

DIOPT Version :9

Sequence 1:NP_610805.1 Gene:CG8778 / 36392 FlyBaseID:FBgn0033761 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_444349.1 Gene:Echs1 / 93747 MGIID:2136460 Length:290 Species:Mus musculus


Alignment Length:298 Identity:99/298 - (33%)
Similarity:155/298 - (52%) Gaps:17/298 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SMLIKRASGLARQLARPLVASRNLASAAPYGDGTEVLVERLDGARQGISVIGLNRPAAKNSFSRG 66
            ::|.:..|.|...:..|.:  |..||.|.:    :.::....|....:.:|.||||.|.|:...|
Mouse     6 ALLPRACSSLLSSVRCPEL--RRFASGANF----QYIITEKKGKNSSVGLIQLNRPKALNALCNG 64

  Fly    67 MVETFNDVLEDIKKDNGSRVVVLRSLSPGIFCAGADLKERKGMTPEE--ATEFVKELRGLLIAIE 129
            ::|..|..||..::|.....:||.. ....|.||||:||.:..|.::  :::|:....    .|.
Mouse    65 LIEELNQALETFEQDPAVGAIVLTG-GDKAFAAGADIKEMQNRTFQDCYSSKFLSHWD----HIT 124

  Fly   130 QLPMPVIAAVDGAALGGGLEMALACDIRTAASDTKMGLVETRLAIIPGAGGTQRLPRILSPALAK 194
            ::..||||||:|.|||||.|:|:.|||..|....:.|..|..|..||||||||||.|.:..:||.
Mouse   125 RVKKPVIAAVNGYALGGGCELAMMCDIIYAGEKAQFGQPEILLGTIPGAGGTQRLTRAVGKSLAM 189

  Fly   195 ELIFTARVFNGAEAKDLGLVNHVVKQNETQDAAYQQALKLAEEILPNGPVGVRMAKLAIDKGMQV 259
            |::.|....:..:||..|||:.:.    ..:...::|::.||:|..|..:.|.|||.:::...::
Mouse   190 EMVLTGDRISAQDAKQAGLVSKIF----PVEKLVEEAIQCAEKIASNSKIVVAMAKESVNAAFEM 250

  Fly   260 DLATGYSIEEICYSQVIPTKDRLEGLAAFAEKRKPVYK 297
            .|..|..:|:..:.....|.||.||:.||.||||..:|
Mouse   251 TLTEGNKLEKRLFYSTFATDDRREGMTAFVEKRKANFK 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8778NP_610805.1 crotonase-like 48..299 CDD:304874 90/252 (36%)
Echs1NP_444349.1 crotonase-like 32..288 CDD:304874 90/268 (34%)
PRK05617 36..288 CDD:235533 90/260 (35%)
Substrate binding. /evidence=ECO:0000250 98..101 2/2 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.