DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8778 and DCI1

DIOPT Version :9

Sequence 1:NP_610805.1 Gene:CG8778 / 36392 FlyBaseID:FBgn0033761 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_014823.3 Gene:DCI1 / 854352 SGDID:S000005706 Length:271 Species:Saccharomyces cerevisiae


Alignment Length:214 Identity:47/214 - (21%)
Similarity:76/214 - (35%) Gaps:64/214 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 AAKNSFSRGMVETFNDVLEDIKKDNGSRVVVLRSLSPGIFCAGADLKERKGMTPEEATEFVKELR 122
            :|.|..:.|      ||..:::|  .|::|...| ||.||.|.|....:|               
Yeast    67 SAVNKLNDG------DVTSEVEK--VSKLVSAIS-SPNIFVANAFAIHKK--------------- 107

  Fly   123 GLLIAIEQLPMPVIAAVDGAALGGGLEMALACDIRTAASDTKMGLVE-TRLAIIPGAGGTQRLPR 186
                       .::..::|.|:|....:...|||..:.:|:...|.. :.|..:...|.:..|.:
Yeast   108 -----------VLVCCLNGPAIGLSASLVALCDIVYSQNDSVFLLFPFSNLGFVAEVGTSVTLTQ 161

  Fly   187 IL------------SPALAKELIFT----------ARVFNGAEAKDL-----GLV-NHVVKQNET 223
            .|            :|.|.||||.|          ...||....:|:     ||. ..|:...|.
Yeast   162 KLGINSANEHMIFSTPVLFKELIGTIITKNYQLTNTETFNEKVLQDIKQNLEGLYPKSVLGMKEL 226

  Fly   224 QDAAYQQALKLAEEILPNG 242
            ..:..:|.|..|:.:..||
Yeast   227 LHSEMKQKLIKAQAMETNG 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8778NP_610805.1 crotonase-like 48..299 CDD:304874 47/214 (22%)
DCI1NP_014823.3 CaiD 1..264 CDD:223955 47/214 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.