DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8778 and EHD3

DIOPT Version :9

Sequence 1:NP_610805.1 Gene:CG8778 / 36392 FlyBaseID:FBgn0033761 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_010321.1 Gene:EHD3 / 851606 SGDID:S000002443 Length:500 Species:Saccharomyces cerevisiae


Alignment Length:315 Identity:91/315 - (28%)
Similarity:132/315 - (41%) Gaps:70/315 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 NLASAAPYGDGTEVLVERLDGARQGISVIGLNRPAAKNSFSRGMVETFNDVLEDIKKDNGSRVVV 88
            |:..|.|      ||....|.||    ||.||||...|:.:..|.|:....|.:..|.:.:.:|:
Yeast    32 NVTDAPP------VLFTVQDTAR----VITLNRPKKLNALNAEMSESMFKTLNEYAKSDTTNLVI 86

  Fly    89 LRSLS-PGIFCAGADLKERKGMTPEEAT--------EFVKELR------GLLIAIEQLPMPVIAA 138
            |:|.: |..||||.|:          ||        ||.|.::      .|...|.....|::..
Yeast    87 LKSSNRPRSFCAGGDV----------ATVAIFNFNKEFAKSIKFFTDEYSLNFQIATYLKPIVTF 141

  Fly   139 VDGAALGGGLEMALACDIRTAASDTKMGLVETRLAIIPGAGGTQRLPRILSPA-----LAKELIF 198
            :||..:|||:.:::....|.|..:||..:.|..:...|..|.|..||||::.|     :|..|..
Yeast   142 MDGITMGGGVGLSIHTPFRIATENTKWAMPEMDIGFFPDVGSTFALPRIVTLANSNSQMALYLCL 206

  Fly   199 TARVFNGAEAKDLGLVNHVVKQNETQDAAYQQALKLAEEILP---NGPVGV---RMAKLAIDK-- 255
            |..|..||:|..|||.:|.| .:|..||..    |...||.|   |.|...   .|...:||:  
Yeast   207 TGEVVTGADAYMLGLASHYV-SSENLDALQ----KRLGEISPPFNNDPQSAYFFGMVNESIDEFV 266

  Fly   256 -GMQVDLATGYSIE-----EICYS--------QVIPTKDRLEGLA---AFAEKRK 293
             .:..|....||.|     |.|::        .::....:.||.|   |||::.|
Yeast   267 SPLPKDYVFKYSNEKLNVIEACFNLSKNGTIEDIMNNLRQYEGSAEGKAFAQEIK 321

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8778NP_610805.1 crotonase-like 48..299 CDD:304874 83/291 (29%)
EHD3NP_010321.1 ECH_2 48..386 CDD:406503 84/293 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.